Recombinant Human RARRES2 Protein, His-tagged

Cat.No. : RARRES2-002H
Product Overview : Recombinant Human RARRES2 Protein (21-157aa) fused to His-tag at C-terminus was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 21-157 a.a.
Description : This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi.
Form : Liquid
Molecular Mass : 16.6kDa (143aa)
13.5-18KDa (SDS-PAGE under reducing conditions.)
AA Sequence : ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSHHHHHH
Endotoxin : < 1.0 EU per 1ug of protein (determined by LAL method)
Purity : > 90% by SDS - PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/ml (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name RARRES2 retinoic acid receptor responder 2 [ Homo sapiens (human) ]
Official Symbol RARRES2
Synonyms RARRES2; retinoic acid receptor responder 2; TIG2; HP10433; retinoic acid receptor responder protein 2; RAR-responsive protein TIG2; chemerin; retinoic acid receptor responder (tazarotene induced) 2; tazarotene-induced gene 2 protein
Gene ID 5919
mRNA Refseq NM_002889
Protein Refseq NP_002880
MIM 601973
UniProt ID Q99969

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RARRES2 Products

Required fields are marked with *

My Review for All RARRES2 Products

Required fields are marked with *

0
cart-icon