Active Recombinant Human RAC2 Protein, His tagged

• Cat.No.: RAC2-4536H
• Product Overview: RAC2 Protein, Human (His) is the recombinant human-derived RAC2 protein, expressed by E.coli , with N-His labeled tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-189 aa
• Description: This gene encodes a member of the Ras superfamily of small guanosine triphosphate (GTP)-metabolizing proteins. The encoded protein localizes to the plasma membrane, where it regulates diverse processes, such as secretion, phagocytosis, and cell polarization. Activity of this protein is also involved in the generation of reactive oxygen species. Mutations in this gene are associated with neutrophil immunodeficiency syndrome. There is a pseudogene for this gene on chromosome 6.
• Form: Lyophilized powder
• Bio-activity: The specific activity was determined to be 8.58 nmol/min/mg in a GTPase-Glo assay using GTP solution substrate.
• Molecular Mass: Approximately 25 kDa
• AASequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRAC
• Purity: > 95% as determined by reducing SDS-PAGE
• Storage: Stored at -20 centigrade for 2 years from date of receipt. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 or -80 centigrade for extended storage.
• Reconstitution: It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Gene Information

• Gene Name: RAC2 Rac family small GTPase 2 [ Homo sapiens (human) ]
• Official Symbol: RAC2
• Synonyms: RAC2; Rac family small GTPase 2; Gx; EN-7; IMD73A; IMD73B; IMD73C; HSPC022; p21-Rac2; ras-related C3 botulinum toxin substrate 2; Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP-binding protein Rac2); ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2); small G protein; EC 3.6.5.2
• Gene ID: 5880
• mRNA Refseq: NM_002872
• Protein Refseq: NP_002863
• MIM: 602049
• UniProt ID: P15153