Recombinant Human RASGRP1 protein, His-tagged
Cat.No. : | RASGRP1-2922H |
Product Overview : | Recombinant Human RASGRP1 protein(678-797 aa), fused to His tag, was expressed in E. coli. |
Availability | September 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 678-797 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RASGRP1 RAS guanyl releasing protein 1 (calcium and DAG-regulated) [ Homo sapiens ] |
Official Symbol | RASGRP1 |
Synonyms | RASGRP1; RAS guanyl releasing protein 1 (calcium and DAG-regulated); RAS guanyl-releasing protein 1; CalDAG GEFII; RASGRP; ras activator RasGRP; RAS guanyl nucleotide-releasing protein 1; calcium and DAG-regulated guanine nucleotide exchange factor II; guanine nucleotide exchange factor, calcium- and DAG-regulated, Rap1A; V; hRasGRP1; CALDAG-GEFI; CALDAG-GEFII; MGC129998; MGC129999; |
Gene ID | 10125 |
mRNA Refseq | NM_001128602 |
Protein Refseq | NP_001122074 |
MIM | 603962 |
UniProt ID | O95267 |
◆ Recombinant Proteins | ||
RASGRP1-13953M | Recombinant Mouse RASGRP1 Protein | +Inquiry |
RASGRP1-4596R | Recombinant Rat RASGRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RASGRP1-7437M | Recombinant Mouse RASGRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RASGRP1-4937R | Recombinant Rat RASGRP1 Protein | +Inquiry |
Rasgrp1-5389M | Recombinant Mouse Rasgrp1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASGRP1-2506HCL | Recombinant Human RASGRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RASGRP1 Products
Required fields are marked with *
My Review for All RASGRP1 Products
Required fields are marked with *