Recombinant Human RASGRP1 protein, His-tagged

Cat.No. : RASGRP1-2922H
Product Overview : Recombinant Human RASGRP1 protein(678-797 aa), fused to His tag, was expressed in E. coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 678-797 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : QPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name RASGRP1 RAS guanyl releasing protein 1 (calcium and DAG-regulated) [ Homo sapiens ]
Official Symbol RASGRP1
Synonyms RASGRP1; RAS guanyl releasing protein 1 (calcium and DAG-regulated); RAS guanyl-releasing protein 1; CalDAG GEFII; RASGRP; ras activator RasGRP; RAS guanyl nucleotide-releasing protein 1; calcium and DAG-regulated guanine nucleotide exchange factor II; guanine nucleotide exchange factor, calcium- and DAG-regulated, Rap1A; V; hRasGRP1; CALDAG-GEFI; CALDAG-GEFII; MGC129998; MGC129999;
Gene ID 10125
mRNA Refseq NM_001128602
Protein Refseq NP_001122074
MIM 603962
UniProt ID O95267

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RASGRP1 Products

Required fields are marked with *

My Review for All RASGRP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon