Recombinant Human RB1 protein, His-tagged
Cat.No. : | RB1-4558H |
Product Overview : | Recombinant Human RB1 protein(P06400)(769-921 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 769-921 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 24.0 kDa |
AASequence : | LQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | RB1 retinoblastoma 1 [ Homo sapiens ] |
Official Symbol | RB1 |
Synonyms | RB1; retinoblastoma 1; OSRC, osteosarcoma; retinoblastoma-associated protein; RB; retinoblastoma suspectibility protein; pRb; OSRC; pp110; p105-Rb; |
Gene ID | 5925 |
mRNA Refseq | NM_000321 |
Protein Refseq | NP_000312 |
MIM | 614041 |
UniProt ID | P06400 |
◆ Recombinant Proteins | ||
RB1-173H | Recombinant Human RB1 protein, T7/His-tagged | +Inquiry |
RB1-195H | Recombinant Human RB1 protein | +Inquiry |
RB1-651H | Recombinant Human RB1 | +Inquiry |
RB1-2197H | Recombinant Human RB1, GST-tagged | +Inquiry |
RB1-5989C | Recombinant Chicken RB1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RB1 Products
Required fields are marked with *
My Review for All RB1 Products
Required fields are marked with *