Recombinant Human RB1 protein, T7/His-tagged

Cat.No. : RB1-173H
Product Overview : Recombinant human RB1 pocket domain cDNA (372 -787 aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKR VKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEV VMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSP LFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLK STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNID LKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR
Purity : >90% by SDS-PAGE.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name RB1 retinoblastoma 1 [ Homo sapiens ]
Official Symbol RB1
Synonyms RB1; retinoblastoma 1; OSRC, osteosarcoma; retinoblastoma-associated protein; RB; retinoblastoma suspectibility protein; pRb; OSRC; pp110; p105-Rb;
Gene ID 5925
mRNA Refseq NM_000321
Protein Refseq NP_000312
MIM 614041
UniProt ID P06400
Chromosome Location 13q14.2
Pathway Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function DNA binding; RNA polymerase II activating transcription factor binding; androgen receptor binding; core promoter binding; kinase activity; kinase binding; molecular_function; phosphoprotein binding; protein binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; transcription factor binding; ubiquitin protein ligase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RB1 Products

Required fields are marked with *

My Review for All RB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon