Recombinant Human RB1 protein, T7/His-tagged
| Cat.No. : | RB1-173H |
| Product Overview : | Recombinant human RB1 pocket domain cDNA (372 -787 aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKR VKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEV VMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSP LFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLK STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNID LKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
| Gene Name | RB1 retinoblastoma 1 [ Homo sapiens ] |
| Official Symbol | RB1 |
| Synonyms | RB1; retinoblastoma 1; OSRC, osteosarcoma; retinoblastoma-associated protein; RB; retinoblastoma suspectibility protein; pRb; OSRC; pp110; p105-Rb; |
| Gene ID | 5925 |
| mRNA Refseq | NM_000321 |
| Protein Refseq | NP_000312 |
| MIM | 614041 |
| UniProt ID | P06400 |
| Chromosome Location | 13q14.2 |
| Pathway | Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; |
| Function | DNA binding; RNA polymerase II activating transcription factor binding; androgen receptor binding; core promoter binding; kinase activity; kinase binding; molecular_function; phosphoprotein binding; protein binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; transcription factor binding; ubiquitin protein ligase binding; |
| ◆ Recombinant Proteins | ||
| RB1-1283R | Recombinant Rat NSF Protein (721-919 aa), His-tagged | +Inquiry |
| RB1-902H | Recombinant Human RB1 protein, His-GST-tagged | +Inquiry |
| RB1-195H | Recombinant Human RB1 protein | +Inquiry |
| RB1-3618R | Recombinant Rhesus Macaque RB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RB1-570H | Recombinant Human RB1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RB1 Products
Required fields are marked with *
My Review for All RB1 Products
Required fields are marked with *
