"RB1" Related Products

Expand
Expand
Expand

Recombinant Human RB1 protein, T7/His-tagged

Cat.No.: RB1-173H
Product Overview: Recombinant human RB1 pocket domain cDNA (372 -787 aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKR VKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEV VMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSP LFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLK STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNID LKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR
Purity: >90% by SDS-PAGE.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: RB1 retinoblastoma 1 [ Homo sapiens ]
Official Symbol: RB1
Synonyms: RB1; retinoblastoma 1; OSRC, osteosarcoma; retinoblastoma-associated protein; RB; retinoblastoma suspectibility protein; pRb; OSRC; pp110; p105-Rb;
Gene ID: 5925
mRNA Refseq: NM_000321
Protein Refseq: NP_000312
MIM: 614041
UniProt ID: P06400
Chromosome Location: 13q14.2
Pathway: Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function: DNA binding; RNA polymerase II activating transcription factor binding; androgen receptor binding; core promoter binding; kinase activity; kinase binding; molecular_function; phosphoprotein binding; protein binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; transcription factor binding; ubiquitin protein ligase binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.