Recombinant Human RBM39 protein, GST-tagged
| Cat.No. : | RBM39-245H |
| Product Overview : | Recombinant Human RBM39 (1 a.a. - 524 a.a.), fussed with GST tag at N-terminal, was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1 a.a. - 524 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 85.1 kDa |
| AA Sequence : | MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRDRERKKSKSRERKRSR SKERRRSRSRSRDRRFRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVREPIDNLTPEER DARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIV QASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSD SECAKKALEQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAA QQALQMSGSLAFGAVADLQTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNK HGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR |
| Applications : | Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | RBM39 RNA binding motif protein 39 [ Homo sapiens ] |
| Official Symbol | RBM39 |
| Synonyms | RBM39; RNA binding motif protein 39; RNA binding region (RNP1, RRM) containing 2 , RNPC2; RNA-binding protein 39; CAPER; CC1.3; fSAP59; functional spliceosome associated protein 59; HCC1; splicing factor HCC1; hepatocellular carcinoma protein 1; RNA-binding region (RNP1, RRM) containing 2; functional spliceosome-associated protein 59; coactivator of activating protein-1 and estrogen receptors; RNPC2; FSAP59; CAPERalpha; FLJ44170; DKFZp781C0423; |
| Gene ID | 9584 |
| mRNA Refseq | NM_004902 |
| Protein Refseq | NP_004893 |
| MIM | 604739 |
| UniProt ID | Q14498 |
| Chromosome Location | 20q11.22 |
| Pathway | mRNA processing, organism-specific biosystem; |
| Function | RNA binding; nucleic acid binding; nucleotide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| RBM39-245H | Recombinant Human RBM39 protein, GST-tagged | +Inquiry |
| RBM39-14005M | Recombinant Mouse RBM39 Protein | +Inquiry |
| RBM39-2216H | Recombinant Human RBM39 protein, GST-tagged | +Inquiry |
| RBM39-246H | Recombinant Human RBM39 protein, GST-tagged | +Inquiry |
| RBM39-7480M | Recombinant Mouse RBM39 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBM39-2470HCL | Recombinant Human RBM39 293 Cell Lysate | +Inquiry |
| RBM39-2471HCL | Recombinant Human RBM39 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM39 Products
Required fields are marked with *
My Review for All RBM39 Products
Required fields are marked with *
