Recombinant Human RBMXL2 protein, His-tagged
Cat.No. : | RBMXL2-5745H |
Product Overview : | Recombinant Human RBMXL2 protein(271-392 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 271-392 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | GDHLSRGSHREPFESYGELRGAAPGRGTPPSYGGGGRYEEYRGYSPDAYSGGRDSYSSSYGRSDRYSRGRHRVGRPDRGLSLSMERGCPPQRDSYSRSGCRVPRGGGRLGGRLERGGGRSRY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | RBMXL2 RNA binding motif protein, X-linked-like 2 [ Homo sapiens ] |
Official Symbol | RBMXL2 |
Synonyms | RBMXL2; RNA binding motif protein, X-linked-like 2; RNA-binding motif protein, X-linked-like-2; heterogeneous nuclear ribonucleoprotein G T; HNRNPG T; HNRPGT; hnRNP G-T; testes specific heterogenous nuclear ribonucleoprotein G T; testes-specific heterogenous nuclear ribonucleoprotein G-T; testis-specific heterogeneous nuclear ribonucleoprotein G-T; HNRNPGT; HNRNPG-T; |
Gene ID | 27288 |
mRNA Refseq | NM_014469 |
Protein Refseq | NP_055284 |
MIM | 605444 |
UniProt ID | O75526 |
◆ Recombinant Proteins | ||
RBMXL2-5744H | Recombinant Human RBMXL2 protein, GST-tagged | +Inquiry |
RBMXL2-592C | Recombinant Cynomolgus Monkey RBMXL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBMXL2-4902H | Recombinant Human RBMXL2 Protein, GST-tagged | +Inquiry |
RBMXL2-5745H | Recombinant Human RBMXL2 protein, His-tagged | +Inquiry |
RBMXL2-849C | Recombinant Cynomolgus RBMXL2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBMXL2 Products
Required fields are marked with *
My Review for All RBMXL2 Products
Required fields are marked with *