Recombinant Human RBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RBP2-1523H |
| Product Overview : | RBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004155) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle. |
| Molecular Mass : | 15.5 kDa |
| AA Sequence : | MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RBP2 retinol binding protein 2 [ Homo sapiens (human) ] |
| Official Symbol | RBP2 |
| Synonyms | RBP2; retinol binding protein 2, cellular; retinol-binding protein 2; CRABP II; CRBP2; CRBPII; RBPC2; CRBP-II; cellular retinol-binding protein II; retinol-binding protein 2, cellular; CRABP-II; |
| Gene ID | 5948 |
| mRNA Refseq | NM_004164 |
| Protein Refseq | NP_004155 |
| MIM | 180280 |
| UniProt ID | P50120 |
| ◆ Recombinant Proteins | ||
| RBP2-4821C | Recombinant Chicken RBP2 | +Inquiry |
| RBP2-3826R | Recombinant Rhesus monkey RBP2 Protein, His-tagged | +Inquiry |
| RBP2-30008TH | Recombinant Human RBP2 | +Inquiry |
| Rbp2-543R | Recombinant Rat Rbp2 Protein, His-tagged | +Inquiry |
| RBP2-3415H | Recombinant Human RBP2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBP2-533HCL | Recombinant Human RBP2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBP2 Products
Required fields are marked with *
My Review for All RBP2 Products
Required fields are marked with *
