Recombinant Human RBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RBP2-1523H
Product Overview : RBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004155) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle.
Molecular Mass : 15.5 kDa
AA Sequence : MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RBP2 retinol binding protein 2 [ Homo sapiens (human) ]
Official Symbol RBP2
Synonyms RBP2; retinol binding protein 2, cellular; retinol-binding protein 2; CRABP II; CRBP2; CRBPII; RBPC2; CRBP-II; cellular retinol-binding protein II; retinol-binding protein 2, cellular; CRABP-II;
Gene ID 5948
mRNA Refseq NM_004164
Protein Refseq NP_004155
MIM 180280
UniProt ID P50120

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBP2 Products

Required fields are marked with *

My Review for All RBP2 Products

Required fields are marked with *

0
cart-icon