Recombinant Human RBP3 protein, His-tagged
| Cat.No. : | RBP3-3912H |
| Product Overview : | Recombinant Human RBP3 protein(898-1247 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 24, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 898-1247 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AMSATTGKAWDLAGVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRVTSEVALAEILGADLQMLSGDPHLKAAHIPENAKDRIPGIVPMQIPSPEVFEELIKFSFHTNVLEDNIGYLRFDMFGDGELLTQVSRLLVEHIWKKIMHTDAMIIDMRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVSELWTHAQVVGERYGSKKSMVILTSSVTAGTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDHL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RBP3 retinol binding protein 3, interstitial [ Homo sapiens ] |
| Official Symbol | RBP3 |
| Synonyms | RBP3; retinol binding protein 3, interstitial; retinol-binding protein 3; D10S64; D10S65; D10S66; interphotoreceptor retinoid-binding protein; IRBP; RBPI; |
| Gene ID | 5949 |
| mRNA Refseq | NM_002900 |
| Protein Refseq | NP_002891 |
| MIM | 180290 |
| UniProt ID | P10745 |
| ◆ Recombinant Proteins | ||
| Rbp3-515R | Recombinant Rat Rbp3 Protein, His-tagged | +Inquiry |
| RBP3-2329B | Recombinant Bovine RBP3 Protein (933-1231 aa), GST-tagged | +Inquiry |
| RBP3-6156H | Recombinant Human RBP3 Protein (Pro19-Leu320), His tagged | +Inquiry |
| RBP3-6254H | Recombinant Human RBP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RBP3-512H | Recombinant Human RBP3 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBP3 Products
Required fields are marked with *
My Review for All RBP3 Products
Required fields are marked with *
