Recombinant Human RBP3 protein, His-tagged
Cat.No. : | RBP3-3912H |
Product Overview : | Recombinant Human RBP3 protein(898-1247 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 898-1247 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AMSATTGKAWDLAGVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRVTSEVALAEILGADLQMLSGDPHLKAAHIPENAKDRIPGIVPMQIPSPEVFEELIKFSFHTNVLEDNIGYLRFDMFGDGELLTQVSRLLVEHIWKKIMHTDAMIIDMRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVSELWTHAQVVGERYGSKKSMVILTSSVTAGTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDHL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RBP3 retinol binding protein 3, interstitial [ Homo sapiens ] |
Official Symbol | RBP3 |
Synonyms | RBP3; retinol binding protein 3, interstitial; retinol-binding protein 3; D10S64; D10S65; D10S66; interphotoreceptor retinoid-binding protein; IRBP; RBPI; |
Gene ID | 5949 |
mRNA Refseq | NM_002900 |
Protein Refseq | NP_002891 |
MIM | 180290 |
UniProt ID | P10745 |
◆ Recombinant Proteins | ||
RBP3-35H | Recombinant Human RBP3 Protein, His-tagged | +Inquiry |
RBP3-1501B | Recombinant Bovine RBP3 Protein (633-1231 aa), His-tagged | +Inquiry |
RBP3-6254H | Recombinant Human RBP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RBP3-01H | Recombinant Human RBP3 Protein, His-tagged | +Inquiry |
RBP3-102HFL | Recombinant Full Length Human RBP3 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBP3 Products
Required fields are marked with *
My Review for All RBP3 Products
Required fields are marked with *
0
Inquiry Basket