Recombinant Human RCN1 Protein (31-331 aa), His-tagged
Cat.No. : | RCN1-1654H |
Product Overview : | Recombinant Human RCN1 Protein (31-331 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 31-331 aa |
Description : | May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 37.7 kDa |
AA Sequence : | PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | RCN1 reticulocalbin 1, EF-hand calcium binding domain [ Homo sapiens ] |
Official Symbol | RCN1 |
Synonyms | RCN1; RCN; reticulocalbin-1; FLJ37041; PIG20; Rcal; RCAL; FLJ55835; |
Gene ID | 5954 |
mRNA Refseq | NM_002901 |
Protein Refseq | NP_002892 |
MIM | 602735 |
UniProt ID | Q15293 |
◆ Recombinant Proteins | ||
RCN1-6631H | Recombinant Human RCN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RCN1-31305TH | Recombinant Human RCN1, His-tagged | +Inquiry |
RCN1-1869H | Recombinant Human RCN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RCN1-2142HFL | Recombinant Full Length Human RCN1 Protein, C-Flag-tagged | +Inquiry |
RCN1-1654H | Recombinant Human RCN1 Protein (31-331 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCN1-2443HCL | Recombinant Human RCN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCN1 Products
Required fields are marked with *
My Review for All RCN1 Products
Required fields are marked with *