Recombinant Human RCN1 Protein (31-331 aa), His-tagged
| Cat.No. : | RCN1-1654H |
| Product Overview : | Recombinant Human RCN1 Protein (31-331 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 31-331 aa |
| Description : | May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 37.7 kDa |
| AA Sequence : | PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | RCN1 reticulocalbin 1, EF-hand calcium binding domain [ Homo sapiens ] |
| Official Symbol | RCN1 |
| Synonyms | RCN1; RCN; reticulocalbin-1; FLJ37041; PIG20; Rcal; RCAL; FLJ55835; |
| Gene ID | 5954 |
| mRNA Refseq | NM_002901 |
| Protein Refseq | NP_002892 |
| MIM | 602735 |
| UniProt ID | Q15293 |
| ◆ Recombinant Proteins | ||
| RCN1-1654H | Recombinant Human RCN1 Protein (31-331 aa), His-tagged | +Inquiry |
| RCN1-31305TH | Recombinant Human RCN1, His-tagged | +Inquiry |
| RCN1-2142HFL | Recombinant Full Length Human RCN1 Protein, C-Flag-tagged | +Inquiry |
| RCN1-2753H | Recombinant Human RCN1, His-tagged | +Inquiry |
| Rcn1-6786M | Recombinant Mouse Rcn1 Protein (Lys24-Leu325), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RCN1-2443HCL | Recombinant Human RCN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCN1 Products
Required fields are marked with *
My Review for All RCN1 Products
Required fields are marked with *
