Recombinant Human RCN1 Protein (31-331 aa), His-tagged

Cat.No. : RCN1-1654H
Product Overview : Recombinant Human RCN1 Protein (31-331 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 31-331 aa
Description : May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 37.7 kDa
AA Sequence : PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name RCN1 reticulocalbin 1, EF-hand calcium binding domain [ Homo sapiens ]
Official Symbol RCN1
Synonyms RCN1; RCN; reticulocalbin-1; FLJ37041; PIG20; Rcal; RCAL; FLJ55835;
Gene ID 5954
mRNA Refseq NM_002901
Protein Refseq NP_002892
MIM 602735
UniProt ID Q15293

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RCN1 Products

Required fields are marked with *

My Review for All RCN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon