Recombinant Human RCVRN Protein, GST-tagged
Cat.No. : | RCVRN-14H |
Product Overview : | Human RCVRN partial ORF (NP_002894.1, 3 a.a. - 99 a.a.) recombinant protein with GST tag at N-terminal was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 3-99 a.a. |
Description : | This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. |
Molecular Mass : | 36.3 kDa |
AA Sequence : | NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RCVRN recoverin [ Homo sapiens (human) ] |
Official Symbol | RCVRN |
Synonyms | RCVRN; recoverin; RCV1; recoverin; cancer associated retinopathy antigen; cancer-associated retinopathy protein |
Gene ID | 5957 |
mRNA Refseq | NM_002903 |
Protein Refseq | NP_002894 |
MIM | 179618 |
UniProt ID | P35243 |
◆ Recombinant Proteins | ||
RCVRN-3835R | Recombinant Rhesus monkey RCVRN Protein, His-tagged | +Inquiry |
RCVRN-3652R | Recombinant Rhesus Macaque RCVRN Protein, His (Fc)-Avi-tagged | +Inquiry |
RCVRN-14H | Recombinant Human RCVRN Protein, GST-tagged | +Inquiry |
RCVRN-2233H | Recombinant Human RCVRN, GST-tagged | +Inquiry |
RCVRN-6160H | Recombinant Human RCVRN Protein (Gly2-Ala200), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCVRN-2442HCL | Recombinant Human RCVRN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RCVRN Products
Required fields are marked with *
My Review for All RCVRN Products
Required fields are marked with *
0
Inquiry Basket