Recombinant Human RCVRN Protein, GST-tagged

Cat.No. : RCVRN-14H
Product Overview : Human RCVRN partial ORF (NP_002894.1, 3 a.a. - 99 a.a.) recombinant protein with GST tag at N-terminal was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 3-99 a.a.
Description : This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy.
Molecular Mass : 36.3 kDa
AA Sequence : NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RCVRN recoverin [ Homo sapiens (human) ]
Official Symbol RCVRN
Synonyms RCVRN; recoverin; RCV1; recoverin; cancer associated retinopathy antigen; cancer-associated retinopathy protein
Gene ID 5957
mRNA Refseq NM_002903
Protein Refseq NP_002894
MIM 179618
UniProt ID P35243

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RCVRN Products

Required fields are marked with *

My Review for All RCVRN Products

Required fields are marked with *

0
cart-icon