Recombinant Human RCVRN Protein, GST-tagged
| Cat.No. : | RCVRN-14H |
| Product Overview : | Human RCVRN partial ORF (NP_002894.1, 3 a.a. - 99 a.a.) recombinant protein with GST tag at N-terminal was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 3-99 a.a. |
| Description : | This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. |
| Molecular Mass : | 36.3 kDa |
| AA Sequence : | NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RCVRN recoverin [ Homo sapiens (human) ] |
| Official Symbol | RCVRN |
| Synonyms | RCVRN; recoverin; RCV1; recoverin; cancer associated retinopathy antigen; cancer-associated retinopathy protein |
| Gene ID | 5957 |
| mRNA Refseq | NM_002903 |
| Protein Refseq | NP_002894 |
| MIM | 179618 |
| UniProt ID | P35243 |
| ◆ Recombinant Proteins | ||
| Rcvrn-5441M | Recombinant Mouse Rcvrn Protein, Myc/DDK-tagged | +Inquiry |
| RCVRN-5057H | Recombinant Human RCVRN protein, His&Myc-tagged | +Inquiry |
| RCVRN-2765H | Recombinant Human RCVRN Protein (2-200 aa), His-Myc-tagged | +Inquiry |
| RCVRN-3652R | Recombinant Rhesus Macaque RCVRN Protein, His (Fc)-Avi-tagged | +Inquiry |
| RCVRN-191H | Recombinant Human Recoverin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RCVRN-2442HCL | Recombinant Human RCVRN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCVRN Products
Required fields are marked with *
My Review for All RCVRN Products
Required fields are marked with *



