Recombinant Human RDX protein, GST-tagged
| Cat.No. : | RDX-6754H |
| Product Overview : | Recombinant Human RDX protein(384-455 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 384-455 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | EEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQED |
| Gene Name | RDX radixin [ Homo sapiens ] |
| Official Symbol | RDX |
| Synonyms | RDX; radixin; deafness, autosomal recessive 24 , DFNB24; DFNB24; |
| Gene ID | 5962 |
| mRNA Refseq | NM_002906 |
| Protein Refseq | NP_002897 |
| MIM | 179410 |
| UniProt ID | P35241 |
| ◆ Recombinant Proteins | ||
| RDX-349H | Recombinant Human RDX | +Inquiry |
| RDX-786HFL | Recombinant Full Length Human RDX Protein, C-Flag-tagged | +Inquiry |
| RDX-8059H | Recombinant Human RDX protein, His & T7-tagged | +Inquiry |
| RDX-429HF | Recombinant Full Length Human RDX Protein | +Inquiry |
| RDX-6754H | Recombinant Human RDX protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RDX-2433HCL | Recombinant Human RDX 293 Cell Lysate | +Inquiry |
| RDX-420HKCL | Human RDX Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RDX Products
Required fields are marked with *
My Review for All RDX Products
Required fields are marked with *
