Recombinant Human REL protein, His-tagged
Cat.No. : | REL-3421H |
Product Overview : | Recombinant Human REL protein(Q04864)(3-616aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 3-616aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 71.9 kDa |
AA Sequence : | SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | REL v-rel reticuloendotheliosis viral oncogene homolog (avian) [ Homo sapiens ] |
Official Symbol | REL |
Synonyms | REL; v-rel reticuloendotheliosis viral oncogene homolog (avian); v rel avian reticuloendotheliosis viral oncogene homolog; proto-oncogene c-Rel; c Rel; I Rel; C-Rel proto-oncogene protein; oncogene REL, avian reticuloendotheliosis; v-rel avian reticuloendotheliosis viral oncogene homolog; C-Rel; |
Gene ID | 5966 |
mRNA Refseq | NM_002908 |
Protein Refseq | NP_002899 |
MIM | 164910 |
UniProt ID | Q04864 |
◆ Recombinant Proteins | ||
REL-250Z | Recombinant Zebrafish REL | +Inquiry |
REL-5508H | Recombinant Human REL protein, His-tagged | +Inquiry |
REL-4018C | Recombinant Chicken REL | +Inquiry |
REL-3421H | Recombinant Human REL protein, His-tagged | +Inquiry |
Rel-2013M | Recombinant Mouse Rel Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REL-2424HCL | Recombinant Human REL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REL Products
Required fields are marked with *
My Review for All REL Products
Required fields are marked with *