Recombinant Human RELA

Cat.No. : RELA-30384TH
Product Overview : Recombinant fragment of Human NFkB p65 with a N terminal proprietary tag; 50.27 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 220 amino acids
Description : NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 50.270kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEG RSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKD PPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC FQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVN RNSGSCLGGDEIFLLCDKVQ
Sequence Similarities : Contains 1 RHD (Rel-like) domain.
Gene Name RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ]
Official Symbol RELA
Synonyms RELA; v-rel reticuloendotheliosis viral oncogene homolog A (avian); NFKB3, nuclear factor of kappa light polypeptide gene enhancer in B cells 3; transcription factor p65; p65;
Gene ID 5970
mRNA Refseq NM_001145138
Protein Refseq NP_001138610
MIM 164014
Uniprot ID Q04206
Chromosome Location 11q13
Pathway Activated TLR4 signalling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem;
Function DNA binding; NF-kappaB binding; activating transcription factor binding; ankyrin repeat binding; chromatin binding;

Quantitation of the Dynamic Profiles of the Innate Immune Response Using Multiplex Selected Reaction Monitoring-Mass Spectrometry

Journal: Molecular & Cellular Proteomics : MCP    PubMed ID: 23418394    Data: 2014/6/1

Authors: Yingxin Zhao, Bing Tian, Allan R. Brasier

Article Snippet:The recombinant proteins full-length human GST-tagged IKKγ and GST-tagged IκBα were made by our laboratory.The recombinant proteins full-length human GST-tagged IKKγ and GST-tagged IκBα were made by our laboratory.. GST-tagged human NFκB2 (1–454 amino acid), N-terminal proprietary tagged human IKKα, His-tagged human MAVS, GST-tagged human TBK1, and recombinant human Rela (1–537 amino acid) were purchased from Creative BioMart (Shirley, NY).. GST-tagged full-length human IRF3 was purchased from Abnova (Walnut, CA), and C-terminal MYC/DDK-tagged human RIG-I protein was purchased from Origene (Rockville, MD).GST-tagged full-length human IRF3 was purchased from Abnova (Walnut, CA), and C-terminal MYC/DDK-tagged human RIG-I protein was purchased from Origene (Rockville, MD).

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RELA Products

Required fields are marked with *

My Review for All RELA Products

Required fields are marked with *

0
cart-icon
0
compare icon