Recombinant Human RELA
| Cat.No. : | RELA-30384TH |
| Product Overview : | Recombinant fragment of Human NFkB p65 with a N terminal proprietary tag; 50.27 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Citation
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 220 amino acids |
| Description : | NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 50.270kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEG RSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKD PPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC FQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVN RNSGSCLGGDEIFLLCDKVQ |
| Sequence Similarities : | Contains 1 RHD (Rel-like) domain. |
| Gene Name | RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ] |
| Official Symbol | RELA |
| Synonyms | RELA; v-rel reticuloendotheliosis viral oncogene homolog A (avian); NFKB3, nuclear factor of kappa light polypeptide gene enhancer in B cells 3; transcription factor p65; p65; |
| Gene ID | 5970 |
| mRNA Refseq | NM_001145138 |
| Protein Refseq | NP_001138610 |
| MIM | 164014 |
| Uniprot ID | Q04206 |
| Chromosome Location | 11q13 |
| Pathway | Activated TLR4 signalling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; |
| Function | DNA binding; NF-kappaB binding; activating transcription factor binding; ankyrin repeat binding; chromatin binding; |
| ◆ Recombinant Proteins | ||
| RELA-634H | Recombinant Human RELA, His-tagged | +Inquiry |
| Rela-5456M | Recombinant Mouse Rela Protein, Myc/DDK-tagged | +Inquiry |
| RELA-6166H | Recombinant Human RELA Protein (Met1-Gln220), N-His tagged | +Inquiry |
| RELA-3525H | Recombinant Human RELA protein, His-tagged | +Inquiry |
| RELA-7009H | Recombinant Human RELA protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RELA-2423HCL | Recombinant Human RELA 293 Cell Lysate | +Inquiry |
Quantitation of the Dynamic Profiles of the Innate Immune Response Using Multiplex Selected Reaction Monitoring-Mass Spectrometry
Journal: Molecular & Cellular Proteomics : MCP PubMed ID: 23418394 Data: 2014/6/1
Authors: Yingxin Zhao, Bing Tian, Allan R. Brasier
Article Snippet:The recombinant proteins full-length human GST-tagged IKKγ and GST-tagged IκBα were made by our laboratory.The recombinant proteins full-length human GST-tagged IKKγ and GST-tagged IκBα were made by our laboratory.. GST-tagged human NFκB2 (1–454 amino acid), N-terminal proprietary tagged human IKKα, His-tagged human MAVS, GST-tagged human TBK1, and recombinant human Rela (1–537 amino acid) were purchased from Creative BioMart (Shirley, NY).. GST-tagged full-length human IRF3 was purchased from Abnova (Walnut, CA), and C-terminal MYC/DDK-tagged human RIG-I protein was purchased from Origene (Rockville, MD).GST-tagged full-length human IRF3 was purchased from Abnova (Walnut, CA), and C-terminal MYC/DDK-tagged human RIG-I protein was purchased from Origene (Rockville, MD).
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RELA Products
Required fields are marked with *
My Review for All RELA Products
Required fields are marked with *



