Recombinant Human RELA protein, His-tagged
Cat.No. : | RELA-3525H |
Product Overview : | Recombinant Human RELA protein(Q04206)(1-210aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-210aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGD |
Gene Name | RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ] |
Official Symbol | RELA |
Synonyms | RELA; v-rel reticuloendotheliosis viral oncogene homolog A (avian); NFKB3, nuclear factor of kappa light polypeptide gene enhancer in B cells 3; transcription factor p65; p65; NF-kappa-B p65delta3; nuclear factor NF-kappa-B p65 subunit; nuclear factor of kappa light polypeptide gene enhancer in B-cells 3; NFKB3; MGC131774; |
Gene ID | 5970 |
mRNA Refseq | NM_001145138 |
Protein Refseq | NP_001138610 |
MIM | 164014 |
UniProt ID | Q04206 |
◆ Recombinant Proteins | ||
RELA-6165H | Recombinant Human RELA Protein (Pro19-Asp291), C-His tagged | +Inquiry |
RELA-333H | Recombinant Human NFκB3 (RELA/p65) Protein, Flag-tagged | +Inquiry |
RELA-7009H | Recombinant Human RELA protein, GST-tagged | +Inquiry |
RELA-634H | Recombinant Human RELA, His-tagged | +Inquiry |
RELA-611H | Recombinant Human RELA protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RELA-2423HCL | Recombinant Human RELA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RELA Products
Required fields are marked with *
My Review for All RELA Products
Required fields are marked with *