Recombinant Human RELT Protein (26-153 aa), His-tagged

Cat.No. : RELT-1219H
Product Overview : Recombinant Human RELT Protein (26-153 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 26-153 aa
Description : Mediates activation of NF-kappa-B. May play a role in T-cell activation.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 17.7 kDa
AA Sequence : STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name RELT RELT tumor necrosis factor receptor [ Homo sapiens ]
Official Symbol RELT
Synonyms RELT; FLJ14993; TRLT; TNFRSF19L;
Gene ID 84957
mRNA Refseq NM_032871
Protein Refseq NP_116260
MIM 611211
UniProt ID Q969Z4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RELT Products

Required fields are marked with *

My Review for All RELT Products

Required fields are marked with *

0
cart-icon
0
compare icon