Recombinant Human RELT Protein (26-153 aa), His-tagged

• Cat.No.: RELT-1219H
• Product Overview: Recombinant Human RELT Protein (26-153 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 26-153 aa
• Description: Mediates activation of NF-kappa-B. May play a role in T-cell activation.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 17.7 kDa
• AA Sequence: STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: RELT RELT tumor necrosis factor receptor [ Homo sapiens ]
• Official Symbol: RELT
• Synonyms: RELT; FLJ14993; TRLT; TNFRSF19L
• Gene ID: 84957
• mRNA Refseq: NM_032871
• Protein Refseq: NP_116260
• MIM: 611211
• UniProt ID: Q969Z4