Recombinant Human RELT Protein (26-153 aa), His-tagged
Cat.No. : | RELT-1219H |
Product Overview : | Recombinant Human RELT Protein (26-153 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 26-153 aa |
Description : | Mediates activation of NF-kappa-B. May play a role in T-cell activation. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 17.7 kDa |
AA Sequence : | STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | RELT RELT tumor necrosis factor receptor [ Homo sapiens ] |
Official Symbol | RELT |
Synonyms | RELT; FLJ14993; TRLT; TNFRSF19L; |
Gene ID | 84957 |
mRNA Refseq | NM_032871 |
Protein Refseq | NP_116260 |
MIM | 611211 |
UniProt ID | Q969Z4 |
◆ Recombinant Proteins | ||
RELT-1219H | Recombinant Human RELT Protein (26-153 aa), His-tagged | +Inquiry |
RELT-11805Z | Recombinant Zebrafish RELT | +Inquiry |
RELT-1826R | Recombinant Rhesus Monkey RELT Protein | +Inquiry |
RELT-6638H | Recombinant Human RELT Protein (Ser26-Ala160), C-His tagged | +Inquiry |
RELT-7521M | Recombinant Mouse RELT Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RELT-2418HCL | Recombinant Human RELT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RELT Products
Required fields are marked with *
My Review for All RELT Products
Required fields are marked with *