Recombinant Human RFC1 Protein, GST-tagged

Cat.No. : RFC1-01H
Product Overview : Human RFC1 partial ORF ( AAH51786, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability.
Molecular Mass : 37.51 kDa
AA Sequence : MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISET
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RFC1 replication factor C subunit 1 [ Homo sapiens (human) ]
Official Symbol RFC1
Synonyms RFC1; replication factor C subunit 1; A1; RFC; PO-GA; RECC1; CANVAS; MHCBFB; RFC140; replication factor C subunit 1; A1 140 kDa subunit; DNA-binding protein PO-GA; MHC binding factor, beta; RF-C 140 kDa subunit; activator 1 140 kDa subunit; activator 1 large subunit; activator 1 subunit 1; replication factor C (activator 1) 1, 145kDa; replication factor C 140 kDa subunit; replication factor C large subunit; replication factor C1
Gene ID 5981
mRNA Refseq NM_002913
Protein Refseq NP_002904
MIM 102579
UniProt ID P35251

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RFC1 Products

Required fields are marked with *

My Review for All RFC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon