Recombinant Human RFC1 Protein, GST-tagged
Cat.No. : | RFC1-01H |
Product Overview : | Human RFC1 partial ORF ( AAH51786, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability. |
Molecular Mass : | 37.51 kDa |
AA Sequence : | MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISET |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RFC1 replication factor C subunit 1 [ Homo sapiens (human) ] |
Official Symbol | RFC1 |
Synonyms | RFC1; replication factor C subunit 1; A1; RFC; PO-GA; RECC1; CANVAS; MHCBFB; RFC140; replication factor C subunit 1; A1 140 kDa subunit; DNA-binding protein PO-GA; MHC binding factor, beta; RF-C 140 kDa subunit; activator 1 140 kDa subunit; activator 1 large subunit; activator 1 subunit 1; replication factor C (activator 1) 1, 145kDa; replication factor C 140 kDa subunit; replication factor C large subunit; replication factor C1 |
Gene ID | 5981 |
mRNA Refseq | NM_002913 |
Protein Refseq | NP_002904 |
MIM | 102579 |
UniProt ID | P35251 |
◆ Recombinant Proteins | ||
RFC1-2319H | Recombinant Human RFC1 Protein (402-492 aa), His-Myc-tagged | +Inquiry |
RFC1-01H | Recombinant Human RFC1 Protein, GST-tagged | +Inquiry |
RFC1-001H | Recombinant Human RFC1 Protein, His-tagged | +Inquiry |
RFC1-1595C | Recombinant Chicken RFC1 | +Inquiry |
RFC1-2394H | Recombinant Human RFC1 Protein (402-492 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RFC1 Products
Required fields are marked with *
My Review for All RFC1 Products
Required fields are marked with *