Recombinant Human RFTN2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RFTN2-4541H |
| Product Overview : | RFTN2 MS Standard C13 and N15-labeled recombinant protein (NP_653230) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | RFTN2 (Raftlin Family Member 2) is a Protein Coding gene. Diseases associated with RFTN2 include Glass Syndrome. An important paralog of this gene is RFTN1. |
| Molecular Mass : | 55.9 kDa |
| AA Sequence : | MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSNPEVIKINSILDIVTKVENYYLKGYIVGAIHPVIQPVGQRKHLPASYLYRVVLLRLKLSPKNSAAPSGQRRPRLVIEECPLTSEAQTNDAAKELIEKINVAAKRGMKFVGFISQHYSPSKFCNGTNHDGDIESMLHVRHGSDENCRSWNEGTLSGQSSESGIEEELHHESGQYQMEQNGSPTSSKSRKGEASDNKLYTVFNAFDDDSTSWAYQEGILSMKVTRKGSVISTLDADWLELTTFYYKQGLSLIDSFVFWETSKGEHLPKSLEGFFIYEEEGSGVPGSSRKGNDAIVVEQWTVIEGCEIKTDYGPLLHTLAEFGWLLTSVLPTPVLRHDSEGNLATKQIVFLQRPVMWNSAAQTPDKKASRHIKGEDKNKATSRSIGLDTTSSQPAESRHLPEECRLSPSRECWTKEGRLAQHNSFSGFSSSDNVLRELDDGQFDQEDGVTQVTCMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RFTN2 raftlin family member 2 [ Homo sapiens (human) ] |
| Official Symbol | RFTN2 |
| Synonyms | RFTN2; raftlin family member 2; C2orf11, chromosome 2 open reading frame 11; raftlin-2; FLJ30574; Raftlin 2; raft-linking protein 2; C2orf11; Raftlin-2; MGC117313; |
| Gene ID | 130132 |
| mRNA Refseq | NM_144629 |
| Protein Refseq | NP_653230 |
| MIM | 618215 |
| UniProt ID | Q52LD8 |
| ◆ Recombinant Proteins | ||
| Rftn2-5479M | Recombinant Mouse Rftn2 Protein, Myc/DDK-tagged | +Inquiry |
| RFTN2-4541H | Recombinant Human RFTN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RFTN2-1276HFL | Recombinant Full Length Human RFTN2 Protein, C-Flag-tagged | +Inquiry |
| RFTN2-1885H | Recombinant Human RFTN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFTN2-3860R | Recombinant Rhesus monkey RFTN2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RFTN2-2402HCL | Recombinant Human RFTN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RFTN2 Products
Required fields are marked with *
My Review for All RFTN2 Products
Required fields are marked with *
