Recombinant Human RFXAP protein, His-tagged
| Cat.No. : | RFXAP-2445H |
| Product Overview : | Recombinant Human RFXAP protein(80-272 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 10, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 80-272 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | DGEEEAGEDEADLLDTSDPPGGGESAASLEDLEDEETHSGGEGSSGGARRRGSGGGSMSKTCTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RFXAP regulatory factor X-associated protein [ Homo sapiens ] |
| Official Symbol | RFXAP |
| Synonyms | RFXAP; regulatory factor X-associated protein; RFX-associated protein; RFX DNA-binding complex 36 kDa subunit; |
| Gene ID | 5994 |
| mRNA Refseq | NM_000538 |
| Protein Refseq | NP_000529 |
| MIM | 601861 |
| UniProt ID | O00287 |
| ◆ Recombinant Proteins | ||
| RFXAP-2445H | Recombinant Human RFXAP protein, His-tagged | +Inquiry |
| RFXAP-3682R | Recombinant Rhesus Macaque RFXAP Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFXAP-7555M | Recombinant Mouse RFXAP Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFXAP-3865R | Recombinant Rhesus monkey RFXAP Protein, His-tagged | +Inquiry |
| RFXAP-2267H | Recombinant Human RFXAP, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RFXAP-1496HCL | Recombinant Human RFXAP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RFXAP Products
Required fields are marked with *
My Review for All RFXAP Products
Required fields are marked with *
