Recombinant Human RGN protein, His-tagged
| Cat.No. : | RGN-7755H |
| Product Overview : | Recombinant Human RGN protein(186-299 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 186-299 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | QISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | RGN regucalcin (senescence marker protein-30) [ Homo sapiens ] |
| Official Symbol | RGN |
| Synonyms | RGN; regucalcin (senescence marker protein-30); regucalcin; RC; senescence marker protein 30; SMP30; SMP-30; gluconolactonase; senescence marker protein-30; GNL; |
| Gene ID | 9104 |
| mRNA Refseq | NM_004683 |
| Protein Refseq | NP_004674 |
| MIM | 300212 |
| UniProt ID | Q15493 |
| ◆ Recombinant Proteins | ||
| RGN-5012R | Recombinant Rat RGN Protein | +Inquiry |
| RGN-1505R | Recombinant Rat RGN Protein (1-299 aa), His-tagged | +Inquiry |
| Rgn-8052R | Recombinant Rat Rgn protein, His & T7-tagged | +Inquiry |
| RGN-4671R | Recombinant Rat RGN Protein, His (Fc)-Avi-tagged | +Inquiry |
| RGN-3642H | Recombinant Human RGN, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RGN-2388HCL | Recombinant Human RGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RGN Products
Required fields are marked with *
My Review for All RGN Products
Required fields are marked with *
