Recombinant Human RGN, His-tagged
Cat.No. : | RGN-30488TH |
Product Overview : | Recombinant full length Human Regucalcin with an N terminal His tag; 319 amino acids with the tag; mwt: 35.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 299 amino acids |
Description : | The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Alternative splicing results in two transcript variants having different 5 UTRs, but encoding the same protein. |
Conjugation : | HIS |
Molecular Weight : | 35.400kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 1.2% Urea |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGG IFKITGLGVKGIAPYSYAG |
Sequence Similarities : | Belongs to the SMP-30/CGR1 family. |
Gene Name | RGN regucalcin (senescence marker protein-30) [ Homo sapiens ] |
Official Symbol | RGN |
Synonyms | RGN; regucalcin (senescence marker protein-30); regucalcin; RC; senescence marker protein 30; SMP30; |
Gene ID | 9104 |
mRNA Refseq | NM_004683 |
Protein Refseq | NP_004674 |
MIM | 300212 |
Uniprot ID | Q15493 |
Chromosome Location | Xp11.3 |
Pathway | Ascorbate and aldarate metabolism, organism-specific biosystem; Ascorbate and aldarate metabolism, conserved biosystem; Ascorbate biosynthesis, animals, glucose-1P => ascorbate, organism-specific biosystem; Ascorbate biosynthesis, animals, glucose-1P => |
Function | calcium ion binding; calcium ion binding; enzyme regulator activity; gluconolactonase activity; hydrolase activity; |
◆ Recombinant Proteins | ||
Rgn-3426R | Recombinant Rat Rgn protein, His-SUMO-tagged | +Inquiry |
Rgn-8051M | Recombinant Mouse Rgn protein, His & T7-tagged | +Inquiry |
RGN-5012R | Recombinant Rat RGN Protein | +Inquiry |
RGN-6294C | Recombinant Chicken RGN | +Inquiry |
RGN-14128M | Recombinant Mouse RGN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGN-2388HCL | Recombinant Human RGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RGN Products
Required fields are marked with *
My Review for All RGN Products
Required fields are marked with *
0
Inquiry Basket