Recombinant Human RGS3 protein, His-tagged
| Cat.No. : | RGS3-5744H |
| Product Overview : | Recombinant Human RGS3 protein(1-241 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-241 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | VIRPGFQRACVAAACTVAARCPGRGVGDRSQSGASYRPICGPKVGGPTEMLRGMYLTRNGNLQRRHTMKEAKDMKNKLGIFRRRSESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | RGS3 regulator of G-protein signaling 3 [ Homo sapiens ] |
| Official Symbol | RGS3 |
| Synonyms | RGS3; regulator of G-protein signaling 3; regulator of G protein signalling 3; C2PA; FLJ20370; PDZ RGS3; regulator of G-protein signalling 3; RGP3; PDZ-RGS3; FLJ31516; FLJ90496; |
| Gene ID | 5998 |
| mRNA Refseq | NM_017790 |
| Protein Refseq | NP_060260 |
| MIM | 602189 |
| UniProt ID | P49796 |
| ◆ Recombinant Proteins | ||
| RGS3-5019R | Recombinant Rat RGS3 Protein | +Inquiry |
| RGS3-6029C | Recombinant Chicken RGS3 | +Inquiry |
| RGS3-29967TH | Recombinant Human RGS3 | +Inquiry |
| RGS3-452HF | Recombinant Full Length Human RGS3 Protein | +Inquiry |
| RGS3-5744H | Recombinant Human RGS3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RGS3-2374HCL | Recombinant Human RGS3 293 Cell Lysate | +Inquiry |
| RGS3-2373HCL | Recombinant Human RGS3 293 Cell Lysate | +Inquiry |
| RGS3-2376HCL | Recombinant Human RGS3 293 Cell Lysate | +Inquiry |
| RGS3-2375HCL | Recombinant Human RGS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RGS3 Products
Required fields are marked with *
My Review for All RGS3 Products
Required fields are marked with *
