Recombinant Human RGS4 protein, GST-tagged

Cat.No. : RGS4-301208H
Product Overview : Recombinant Human RGS4 (21-71 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : His21-Cys71
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : HRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHEC
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name RGS4 regulator of G-protein signaling 4 [ Homo sapiens ]
Official Symbol RGS4
Synonyms RGS4; regulator of G-protein signaling 4; regulator of G protein signalling 4 , schizophrenia disorder 9 , SCZD9; schizophrenia disorder 9; RGP4; SCZD9; MGC2124; MGC60244; DKFZp761F1924;
Gene ID 5999
mRNA Refseq NM_001102445
Protein Refseq NP_001095915
MIM 602516
UniProt ID P49798

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RGS4 Products

Required fields are marked with *

My Review for All RGS4 Products

Required fields are marked with *

0
cart-icon