Recombinant Human RHOA Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | RHOA-160H |
Product Overview : | RHOA MS Standard C13 and N15-labeled recombinant protein (NP_001655) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015] |
Molecular Mass : | 21.8 kDa |
AA Sequence : | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RHOA ras homolog family member A [ Homo sapiens (human) ] |
Official Symbol | RHOA |
Synonyms | RHOA; ras homolog family member A; ARH12; ARHA; RHO12; RHOH12; transforming protein RhoA; Aplysia ras-related homolog 12; epididymis secretory sperm binding protein; oncogene RHO H12; small GTP binding protein RhoA; EC 3.6.5.2 |
Gene ID | 387 |
mRNA Refseq | NM_001664 |
Protein Refseq | NP_001655 |
MIM | 165390 |
UniProt ID | P61586 |
◆ Recombinant Proteins | ||
RHOA-3372H | Recombinant Human Ras Homolog Gene Family, His-tagged | +Inquiry |
RHOA-4694R | Recombinant Rat RHOA Protein, His (Fc)-Avi-tagged | +Inquiry |
Rhoa-641M | Recombinant Mouse Rhoa Protein, MYC/DDK-tagged | +Inquiry |
RHOA-6269C | Recombinant Chicken RHOA | +Inquiry |
RHOA-27379TH | Recombinant Human RHOA | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOA-601HCL | Recombinant Human RHOA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOA Products
Required fields are marked with *
My Review for All RHOA Products
Required fields are marked with *