Recombinant Human RHOA Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : RHOA-160H
Product Overview : RHOA MS Standard C13 and N15-labeled recombinant protein (NP_001655) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]
Molecular Mass : 21.8 kDa
AA Sequence : MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RHOA ras homolog family member A [ Homo sapiens (human) ]
Official Symbol RHOA
Synonyms RHOA; ras homolog family member A; ARH12; ARHA; RHO12; RHOH12; transforming protein RhoA; Aplysia ras-related homolog 12; epididymis secretory sperm binding protein; oncogene RHO H12; small GTP binding protein RhoA; EC 3.6.5.2
Gene ID 387
mRNA Refseq NM_001664
Protein Refseq NP_001655
MIM 165390
UniProt ID P61586

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RHOA Products

Required fields are marked with *

My Review for All RHOA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon