Recombinant Human RHOG, His-tagged
Cat.No. : | RHOG-30980TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 32-191 of Human RHOG with an N terminal His tag; MWt 19kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 32-191 a.a. |
Description : | This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The encoded protein facilitates translocation of a functional guanine nucleotide exchange factor (GEF) complex from the cytoplasm to the plasma membrane where ras-related C3 botulinum toxin substrate 1 is activated to promote lamellipodium formation and cell migration. Two related pseudogene have been identified on chromosomes 20 and X. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 104 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLS YPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVP ILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAK QIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRG RSCILL |
Sequence Similarities : | Belongs to the small GTPase superfamily. Rho family. |
Gene Name | RHOG ras homolog gene family, member G (rho G) [ Homo sapiens ] |
Official Symbol | RHOG |
Synonyms | RHOG; ras homolog gene family, member G (rho G); ARHG; rho-related GTP-binding protein RhoG; MGC125835; MGC125836; RhoG; |
Gene ID | 391 |
mRNA Refseq | NM_001665 |
Protein Refseq | NP_001656 |
MIM | 179505 |
Uniprot ID | P84095 |
Chromosome Location | 11p15.5-p15.4 |
Pathway | Axon guidance, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Developmental Biology, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; |
Function | GTP binding; GTPase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
RHOG-3705R | Recombinant Rhesus Macaque RHOG Protein, His (Fc)-Avi-tagged | +Inquiry |
RHOG-1910C | Recombinant Chicken RHOG | +Inquiry |
RHOG-6843H | Recombinant Human Ras Homolog Family Member G, His-tagged | +Inquiry |
RHOG-683H | Recombinant Human RHOG protein, His-tagged | +Inquiry |
RHOG-30980TH | Recombinant Human RHOG, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOG-542HCL | Recombinant Human RHOG lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RHOG Products
Required fields are marked with *
My Review for All RHOG Products
Required fields are marked with *
0
Inquiry Basket