Recombinant Human RHOG, His-tagged

Cat.No. : RHOG-30980TH
Product Overview : Recombinant fragment, corresponding to amino acids 32-191 of Human RHOG with an N terminal His tag; MWt 19kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 32-191 a.a.
Description : This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The encoded protein facilitates translocation of a functional guanine nucleotide exchange factor (GEF) complex from the cytoplasm to the plasma membrane where ras-related C3 botulinum toxin substrate 1 is activated to promote lamellipodium formation and cell migration. Two related pseudogene have been identified on chromosomes 20 and X.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 104 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLS YPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVP ILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAK QIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRG RSCILL
Sequence Similarities : Belongs to the small GTPase superfamily. Rho family.
Gene Name RHOG ras homolog gene family, member G (rho G) [ Homo sapiens ]
Official Symbol RHOG
Synonyms RHOG; ras homolog gene family, member G (rho G); ARHG; rho-related GTP-binding protein RhoG; MGC125835; MGC125836; RhoG;
Gene ID 391
mRNA Refseq NM_001665
Protein Refseq NP_001656
MIM 179505
Uniprot ID P84095
Chromosome Location 11p15.5-p15.4
Pathway Axon guidance, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Developmental Biology, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem;
Function GTP binding; GTPase activity; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RHOG Products

Required fields are marked with *

My Review for All RHOG Products

Required fields are marked with *

0
cart-icon
0
compare icon