Recombinant Human RHOU protein, GST-tagged
Cat.No. : | RHOU-301420H |
Product Overview : | Recombinant Human RHOU protein(127-220 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 127-220 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | CFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEIKAASYIECSALTQKNLKEVFDAAIV |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | RHOU ras homolog family member U [ Homo sapiens ] |
Official Symbol | RHOU |
Synonyms | RHOU; ras homolog family member U; ARHU, ras homolog gene family, member U; rho-related GTP-binding protein RhoU; 2310026M05Rik; CDC42 like GTPase; CDC42L1; DJ646B12.2; fJ646B12.2; FLJ10616; GTP binding protein like 1; GTP binding protein SB128; hG28K; ras like gene family member U; Ryu GTPase; Wnt 1 responsive Cdc42 homolog; WRCH 1; WRCH1; CDC42-like GTPase 1; GTP-binding protein SB128; GTP-binding protein like 1; rho GTPase-like protein ARHU; ras-like gene family member U; wnt-1 responsive Cdc42 homolog 1; ras homolog gene family, member U; ARHU; |
mRNA Refseq | NM_021205 |
Protein Refseq | NP_067028 |
MIM | 606366 |
UniProt ID | Q7L0Q8 |
Gene ID | 58480 |
◆ Recombinant Proteins | ||
RHOU-7594M | Recombinant Mouse RHOU Protein, His (Fc)-Avi-tagged | +Inquiry |
RHOU-3708R | Recombinant Rhesus Macaque RHOU Protein, His (Fc)-Avi-tagged | +Inquiry |
RHOU-1421H | Recombinant Human RHOU protein, His-tagged | +Inquiry |
RHOU-301420H | Recombinant Human RHOU protein, GST-tagged | +Inquiry |
RHOU-3891R | Recombinant Rhesus monkey RHOU Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RHOU Products
Required fields are marked with *
My Review for All RHOU Products
Required fields are marked with *
0
Inquiry Basket