Recombinant Human RHOU protein, His-tagged

Cat.No. : RHOU-1421H
Product Overview : Recombinant Human RHOU protein(127-220 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 127-220 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : CFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEIKAASYIECSALTQKNLKEVFDAAIV
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name RHOU ras homolog family member U [ Homo sapiens ]
Official Symbol RHOU
Synonyms RHOU; ras homolog family member U; ARHU, ras homolog gene family, member U; rho-related GTP-binding protein RhoU; 2310026M05Rik; CDC42 like GTPase; CDC42L1; DJ646B12.2; fJ646B12.2; FLJ10616; GTP binding protein like 1; GTP binding protein SB128; hG28K; ras like gene family member U; Ryu GTPase; Wnt 1 responsive Cdc42 homolog; WRCH 1; WRCH1; CDC42-like GTPase 1; GTP-binding protein SB128; GTP-binding protein like 1; rho GTPase-like protein ARHU; ras-like gene family member U; wnt-1 responsive Cdc42 homolog 1; ras homolog gene family, member U; ARHU;
mRNA Refseq NM_021205
Protein Refseq NP_067028
MIM 606366
UniProt ID Q7L0Q8
Gene ID 58480

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RHOU Products

Required fields are marked with *

My Review for All RHOU Products

Required fields are marked with *

0
cart-icon
0
compare icon