Recombinant Human RPL26L1 protein, His-tagged
Cat.No. : | RPL26L1-7178H |
Product Overview : | Recombinant Human RPL26L1 protein(1-145 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-145 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | RPL26L1 ribosomal protein L26-like 1 [ Homo sapiens ] |
Official Symbol | RPL26L1 |
Synonyms | RPL26L1; ribosomal protein L26-like 1; RPL26P1; 60S ribosomal protein L26-like 1; ribosomal protein L26 homolog; ribosomal protein L26 pseudogene 1 |
Gene ID | 51121 |
mRNA Refseq | NM_016093 |
Protein Refseq | NP_057177 |
UniProt ID | Q9UNX3 |
◆ Recombinant Proteins | ||
RPL26L1-3981R | Recombinant Rhesus monkey RPL26L1 Protein, His-tagged | +Inquiry |
RPL26L1-7178H | Recombinant Human RPL26L1 protein, His-tagged | +Inquiry |
RPL26L1-2387H | Recombinant Human RPL26L1, GST-tagged | +Inquiry |
RPL26L1-3798R | Recombinant Rhesus Macaque RPL26L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPL26L1-4721C | Recombinant Chicken RPL26L1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL26L1-2212HCL | Recombinant Human RPL26L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPL26L1 Products
Required fields are marked with *
My Review for All RPL26L1 Products
Required fields are marked with *