Recombinant Human RPL26L1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RPL26L1-6314H |
Product Overview : | RPL26L1 MS Standard C13 and N15-labeled recombinant protein (NP_057177) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that shares high sequence similarity with ribosomal protein L26. Alternative splicing results in multiple transcript variants encoding the same protein. |
Molecular Mass : | 17.3 kDa |
AA Sequence : | MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RPL26L1 ribosomal protein L26-like 1 [ Homo sapiens (human) ] |
Official Symbol | RPL26L1 |
Synonyms | RPL26L1; ribosomal protein L26-like 1; RPL26P1; 60S ribosomal protein L26-like 1; ribosomal protein L26 homolog; ribosomal protein L26 pseudogene 1 |
Gene ID | 51121 |
mRNA Refseq | NM_016093 |
Protein Refseq | NP_057177 |
UniProt ID | Q9UNX3 |
◆ Recombinant Proteins | ||
RPL26L1-7178H | Recombinant Human Ribosomal Protein L26-Like 1, His-tagged | +Inquiry |
RPL26L1-3981R | Recombinant Rhesus monkey RPL26L1 Protein, His-tagged | +Inquiry |
RPL26L1-3798R | Recombinant Rhesus Macaque RPL26L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPL26L1-4720C | Recombinant Chicken RPL26L1 | +Inquiry |
RPL26L1-6314H | Recombinant Human RPL26L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL26L1-2212HCL | Recombinant Human RPL26L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPL26L1 Products
Required fields are marked with *
My Review for All RPL26L1 Products
Required fields are marked with *
0
Inquiry Basket