Recombinant Human RPL26L1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RPL26L1-6314H
Product Overview : RPL26L1 MS Standard C13 and N15-labeled recombinant protein (NP_057177) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that shares high sequence similarity with ribosomal protein L26. Alternative splicing results in multiple transcript variants encoding the same protein.
Molecular Mass : 17.3 kDa
AA Sequence : MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RPL26L1 ribosomal protein L26-like 1 [ Homo sapiens (human) ]
Official Symbol RPL26L1
Synonyms RPL26L1; ribosomal protein L26-like 1; RPL26P1; 60S ribosomal protein L26-like 1; ribosomal protein L26 homolog; ribosomal protein L26 pseudogene 1
Gene ID 51121
mRNA Refseq NM_016093
Protein Refseq NP_057177
UniProt ID Q9UNX3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPL26L1 Products

Required fields are marked with *

My Review for All RPL26L1 Products

Required fields are marked with *

0
cart-icon
0
compare icon