Recombinant Human RPL26L1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RPL26L1-6314H
• Product Overview: RPL26L1 MS Standard C13 and N15-labeled recombinant protein (NP_057177) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein that shares high sequence similarity with ribosomal protein L26. Alternative splicing results in multiple transcript variants encoding the same protein.
• Molecular Mass: 17.3 kDa
• AA Sequence: MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RPL26L1 ribosomal protein L26-like 1 [ Homo sapiens (human) ]
• Official Symbol: RPL26L1
• Synonyms: RPL26L1; ribosomal protein L26-like 1; RPL26P1; 60S ribosomal protein L26-like 1; ribosomal protein L26 homolog; ribosomal protein L26 pseudogene 1
• Gene ID: 51121
• mRNA Refseq: NM_016093
• Protein Refseq: NP_057177
• UniProt ID: Q9UNX3