Recombinant Human RIPPLY3 Protein, GST-tagged

Cat.No. : RIPPLY3-2886H
Product Overview : Human DSCR6 full-length ORF ( NP_061835.1, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RIPPLY3 (Ripply Transcriptional Repressor 3) is a Protein Coding gene. Diseases associated with RIPPLY3 include Velocardiofacial Syndrome.
Molecular Mass : 46.8 kDa
AA Sequence : MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSKGAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RIPPLY3 ripply transcriptional repressor 3 [ Homo sapiens (human) ]
Official Symbol RIPPLY3
Synonyms RIPPLY3; ripply transcriptional repressor 3; Ripply Transcriptional Repressor 3; Down Syndrome Critical Region Protein 6; Down Syndrome Critical Region Gene 6; DSCR6; Ripply3 Homolog (Zebrafish); Protein Ripply3; Ripply3 Homolog; protein ripply3; Down syndrome critical region gene 6; down syndrome critical region protein 6; ripply3 homolog
Gene ID 53820
mRNA Refseq NM_001317768
Protein Refseq NP_001304697
MIM 609892
UniProt ID P57055

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RIPPLY3 Products

Required fields are marked with *

My Review for All RIPPLY3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon