Recombinant Human RIPPLY3 Protein, GST-tagged
| Cat.No. : | RIPPLY3-2886H |
| Product Overview : | Human DSCR6 full-length ORF ( NP_061835.1, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | RIPPLY3 (Ripply Transcriptional Repressor 3) is a Protein Coding gene. Diseases associated with RIPPLY3 include Velocardiofacial Syndrome. |
| Molecular Mass : | 46.8 kDa |
| AA Sequence : | MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSKGAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RIPPLY3 ripply transcriptional repressor 3 [ Homo sapiens (human) ] |
| Official Symbol | RIPPLY3 |
| Synonyms | RIPPLY3; ripply transcriptional repressor 3; Ripply Transcriptional Repressor 3; Down Syndrome Critical Region Protein 6; Down Syndrome Critical Region Gene 6; DSCR6; Ripply3 Homolog (Zebrafish); Protein Ripply3; Ripply3 Homolog; protein ripply3; Down syndrome critical region gene 6; down syndrome critical region protein 6; ripply3 homolog |
| Gene ID | 53820 |
| mRNA Refseq | NM_001317768 |
| Protein Refseq | NP_001304697 |
| MIM | 609892 |
| UniProt ID | P57055 |
| ◆ Recombinant Proteins | ||
| RIPPLY3-4200HF | Recombinant Full Length Human RIPPLY3 Protein, GST-tagged | +Inquiry |
| RIPPLY3-3610Z | Recombinant Zebrafish RIPPLY3 | +Inquiry |
| RIPPLY3-2886H | Recombinant Human RIPPLY3 Protein, GST-tagged | +Inquiry |
| Ripply3-5525M | Recombinant Mouse Ripply3 Protein, Myc/DDK-tagged | +Inquiry |
| RIPPLY3-4438H | Recombinant Human RIPPLY3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RIPPLY3 Products
Required fields are marked with *
My Review for All RIPPLY3 Products
Required fields are marked with *
