Recombinant Human RIT1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RIT1-6153H |
Product Overview : | RIT1 MS Standard C13 and N15-labeled recombinant protein (NP_008843) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of a subfamily of Ras-related GTPases. The encoded protein is involved in regulating p38 MAPK-dependent signaling cascades related to cellular stress. This protein also cooperates with nerve growth factor to promote neuronal development and regeneration. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 25.1 kDa |
AA Sequence : | MDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RIT1 Ras-like without CAAX 1 [ Homo sapiens (human) ] |
Official Symbol | RIT1 |
Synonyms | RIT1; Ras-like without CAAX 1; Ric (Drosophila) like, expressed in many tissues, RIT; GTP-binding protein Rit1; GTP binding protein Roc1; MGC125864; MGC125865; RIBB; Ric like; expressed in many tissues; ROC1; GTP-binding protein Roc1; ras-like without CAAX protein 1; Ric-like, expressed in many tissues; ras-like protein expressed in many tissues; RIT; |
Gene ID | 6016 |
mRNA Refseq | NM_006912 |
Protein Refseq | NP_008843 |
MIM | 609591 |
UniProt ID | Q92963 |
◆ Recombinant Proteins | ||
RIT1-3901R | Recombinant Rhesus monkey RIT1 Protein, His-tagged | +Inquiry |
RIT1-7037Z | Recombinant Zebrafish RIT1 | +Inquiry |
RIT1-3718R | Recombinant Rhesus Macaque RIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RIT1-6153H | Recombinant Human RIT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RIT1-2981C | Recombinant Chicken RIT1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RIT1-2330HCL | Recombinant Human RIT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RIT1 Products
Required fields are marked with *
My Review for All RIT1 Products
Required fields are marked with *