Recombinant Human RNASE10 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RNASE10-5971H |
Product Overview : | RNASE10 MS Standard C13 and N15-labeled recombinant protein (NP_001012993) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | RNASE10 (Ribonuclease A Family Member 10 (Inactive)) is a Protein Coding gene. Diseases associated with RNASE10 include Hypotrichosis 6 and Orchitis. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and ribonuclease activity. An important paralog of this gene is RNASE4. |
Molecular Mass : | 24 kDa |
AA Sequence : | MKLNLVQIFFMLLMLLLGLGMGLGLGLHMATAVLEESDQPLNEFWSSDSQDKAEATEEGDGTQTTETLVLSNKEVVQPGWPEDPILGEDEVGGNKMLRASALFQSNKDYLRLDQTDRECNDMMAHKMKEPSQSCIAQYAFIHEDLNTVKAVCNSPVIACELKGGKCHKSSRPFDLTLCELSQPDQVTPNCNYLTSVIKKHIIITCNDMKRQLPTGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RNASE10 ribonuclease A family member 10 (inactive) [ Homo sapiens (human) ] |
Official Symbol | RNASE10 |
Synonyms | RNASE10; ribonuclease A family member 10 (inactive); RAH1; RNASE9; inactive ribonuclease-like protein 10; ribonuclease A H1; ribonuclease, RNase A family, 10 (non-active) |
Gene ID | 338879 |
mRNA Refseq | NM_001012975 |
Protein Refseq | NP_001012993 |
UniProt ID | Q5GAN6 |
◆ Recombinant Proteins | ||
Rnase10-5534M | Recombinant Mouse Rnase10 Protein, Myc/DDK-tagged | +Inquiry |
RNASE10-5057R | Recombinant Rat RNASE10 Protein | +Inquiry |
RNASE10-1556H | Recombinant Human RNASE10 protein, His-tagged | +Inquiry |
RNASE10-4716R | Recombinant Rat RNASE10 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNASE10-5971H | Recombinant Human RNASE10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNASE10-2324HCL | Recombinant Human RNASE10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASE10 Products
Required fields are marked with *
My Review for All RNASE10 Products
Required fields are marked with *