Recombinant Human RNASE7 protein, GST-tagged
Cat.No. : | RNASE7-29H |
Product Overview : | Recombinant Human RNASE7(1 a.a. - 156 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-156 a.a. |
Description : | The protein encoded by this gene belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein has broad-spectrum antimicrobial activity against bacteria and fungi. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 43.9 kDa |
AA Sequence : | MAPARAGFCPLLLLLLLGLWVAEIPVSAKPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEP FSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPV HLDRVL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | RNASE7 ribonuclease, RNase A family, 7 [ Homo sapiens ] |
Official Symbol | RNASE7 |
Synonyms | RNASE7; ribonuclease, RNase A family, 7; ribonuclease 7; SAP-2; RNase 7; skin-derived antimicrobial protein 2; MGC133220; |
Gene ID | 84659 |
mRNA Refseq | NM_032572 |
Protein Refseq | NP_115961 |
MIM | 612484 |
UniProt ID | Q9H1E1 |
Chromosome Location | 14q11.1 |
Function | endonuclease activity; hydrolase activity; nucleic acid binding; pancreatic ribonuclease activity; ribonuclease activity; |
◆ Recombinant Proteins | ||
RNASE7-645HF | Recombinant Full Length Human RNASE7 Protein, GST-tagged | +Inquiry |
RNASE7-705H | Recombinant Human RNase 7 Protein | +Inquiry |
RNASE7-6634H | Recombinant Human RNASE7 Protein (Lys31-Val155), N-His tagged | +Inquiry |
RNASE7-8643H | Recombinant Human RNASE7 protein, hFc-tagged | +Inquiry |
RNASE7-29H | Recombinant Human RNASE7 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNASE7-2317HCL | Recombinant Human RNASE7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASE7 Products
Required fields are marked with *
My Review for All RNASE7 Products
Required fields are marked with *