"RNASE7" Related Products

Expand
Expand

Recombinant Human RNASE7 protein, GST-tagged

Cat.No.: RNASE7-29H
Product Overview: Recombinant Human RNASE7(1 a.a. - 156 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: The protein encoded by this gene belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein has broad-spectrum antimicrobial activity against bacteria and fungi.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 43.9 kDa
AA Sequence: MAPARAGFCPLLLLLLLGLWVAEIPVSAKPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEP FSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPV HLDRVL
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: RNASE7 ribonuclease, RNase A family, 7 [ Homo sapiens ]
Official Symbol: RNASE7
Synonyms: RNASE7; ribonuclease, RNase A family, 7; ribonuclease 7; SAP-2; RNase 7; skin-derived antimicrobial protein 2; MGC133220;
Gene ID: 84659
mRNA Refseq: NM_032572
Protein Refseq: NP_115961
MIM: 612484
UniProt ID: Q9H1E1
Chromosome Location: 14q11.1
Function: endonuclease activity; hydrolase activity; nucleic acid binding; pancreatic ribonuclease activity; ribonuclease activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.