Recombinant Human RNASEL protein, GST-tagged

Cat.No. : RNASEL-25H
Product Overview : Recombinant Human RNASEL(619 a.a. - 728 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 619-728 a.a.
Description : This gene encodes a component of the interferon-regulated 2-5A system that functions in the antiviral and antiproliferative roles of interferons. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candidate for the hereditary prostate cancer 1 (HPC1) allele
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : QPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name RNASEL ribonuclease L (2,5-oligoisoadenylate synthetase-dependent) [ Homo sapiens ]
Official Symbol RNASEL
Synonyms RNASEL; ribonuclease L (2,5-oligoisoadenylate synthetase-dependent); PRCA1, prostate cancer 1 , RNS4; 2-5A-dependent ribonuclease; RNase L; ribonuclease 4; 2-5A-dependent RNase; interferon-induced 2-5A-dependent RNase; 2,5-oligoisoadenylate synthetase-dependent; RNS4; PRCA1; MGC104972; MGC133329; DKFZp781D08126;
Gene ID 6041
mRNA Refseq NM_021133
Protein Refseq NP_066956
MIM 180435
UniProt ID Q05823
Chromosome Location 1q25
Pathway Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Immune System, organism-specific biosystem; Influenza A, organism-specific biosystem;
Function ATP binding; RNA binding; endoribonuclease activity; endoribonuclease activity, producing 5-phosphomonoesters; hydrolase activity; metal ion binding; nucleotide binding; protein kinase activity; transferase activity, transferring phosphorus-containing groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNASEL Products

Required fields are marked with *

My Review for All RNASEL Products

Required fields are marked with *

0
cart-icon