Recombinant Human RNASEL protein, GST-tagged
Cat.No. : | RNASEL-25H |
Product Overview : | Recombinant Human RNASEL(619 a.a. - 728 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 619-728 a.a. |
Description : | This gene encodes a component of the interferon-regulated 2-5A system that functions in the antiviral and antiproliferative roles of interferons. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candidate for the hereditary prostate cancer 1 (HPC1) allele |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | QPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | RNASEL ribonuclease L (2,5-oligoisoadenylate synthetase-dependent) [ Homo sapiens ] |
Official Symbol | RNASEL |
Synonyms | RNASEL; ribonuclease L (2,5-oligoisoadenylate synthetase-dependent); PRCA1, prostate cancer 1 , RNS4; 2-5A-dependent ribonuclease; RNase L; ribonuclease 4; 2-5A-dependent RNase; interferon-induced 2-5A-dependent RNase; 2,5-oligoisoadenylate synthetase-dependent; RNS4; PRCA1; MGC104972; MGC133329; DKFZp781D08126; |
Gene ID | 6041 |
mRNA Refseq | NM_021133 |
Protein Refseq | NP_066956 |
MIM | 180435 |
UniProt ID | Q05823 |
Chromosome Location | 1q25 |
Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Immune System, organism-specific biosystem; Influenza A, organism-specific biosystem; |
Function | ATP binding; RNA binding; endoribonuclease activity; endoribonuclease activity, producing 5-phosphomonoesters; hydrolase activity; metal ion binding; nucleotide binding; protein kinase activity; transferase activity, transferring phosphorus-containing groups; |
◆ Recombinant Proteins | ||
RNASEL-5070H | Recombinant Human RNASEL Protein (Ile358-His583), His tagged | +Inquiry |
RNASEL-6893HFL | Recombinant Full Length Human RNASEL protein, Flag-tagged | +Inquiry |
RNASEL-3815H | Recombinant Human RNASEL protein, His-SUMO-tagged | +Inquiry |
RNASEL-2657H | Recombinant Human RNASEL Protein, His-tagged | +Inquiry |
RNASEL-36H | Recombinant Human RNASEL protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNASEL Products
Required fields are marked with *
My Review for All RNASEL Products
Required fields are marked with *
0
Inquiry Basket