Recombinant Human RNASEL protein, His-SUMO-tagged
Cat.No. : | RNASEL-3815H |
Product Overview : | Recombinant Human RNASEL protein(Q05823)(330-741aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 330-741aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 63.4 kDa |
AA Sequence : | HPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RNASEL ribonuclease L (2,5-oligoisoadenylate synthetase-dependent) [ Homo sapiens ] |
Official Symbol | RNASEL |
Synonyms | RNASEL; ribonuclease L (2,5-oligoisoadenylate synthetase-dependent); PRCA1, prostate cancer 1 , RNS4; 2-5A-dependent ribonuclease; RNase L; ribonuclease 4; 2-5A-dependent RNase; interferon-induced 2-5A-dependent RNase; 2,5-oligoisoadenylate synthetase-dependent; RNS4; PRCA1; MGC104972; MGC133329; DKFZp781D08126; |
Gene ID | 6041 |
mRNA Refseq | NM_021133 |
Protein Refseq | NP_066956 |
MIM | 180435 |
UniProt ID | Q05823 |
◆ Recombinant Proteins | ||
RNASEL-2329H | Recombinant Human RNASEL, His-tagged | +Inquiry |
RNASEL-25H | Recombinant Human RNASEL protein, GST-tagged | +Inquiry |
RNASEL-37H | Recombinant Full Length Human RNASEL Protein, Myc-tagged | +Inquiry |
RNASEL-6893HFL | Recombinant Full Length Human RNASEL protein, Flag-tagged | +Inquiry |
RNASEL-3916R | Recombinant Rhesus monkey RNASEL Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASEL Products
Required fields are marked with *
My Review for All RNASEL Products
Required fields are marked with *