Recombinant Human RNASEL protein, His-SUMO-tagged
| Cat.No. : | RNASEL-3815H |
| Product Overview : | Recombinant Human RNASEL protein(Q05823)(330-741aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 330-741aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 63.4 kDa |
| AA Sequence : | HPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | RNASEL ribonuclease L (2,5-oligoisoadenylate synthetase-dependent) [ Homo sapiens ] |
| Official Symbol | RNASEL |
| Synonyms | RNASEL; ribonuclease L (2,5-oligoisoadenylate synthetase-dependent); PRCA1, prostate cancer 1 , RNS4; 2-5A-dependent ribonuclease; RNase L; ribonuclease 4; 2-5A-dependent RNase; interferon-induced 2-5A-dependent RNase; 2,5-oligoisoadenylate synthetase-dependent; RNS4; PRCA1; MGC104972; MGC133329; DKFZp781D08126; |
| Gene ID | 6041 |
| mRNA Refseq | NM_021133 |
| Protein Refseq | NP_066956 |
| MIM | 180435 |
| UniProt ID | Q05823 |
| ◆ Recombinant Proteins | ||
| RNASEL-36H | Recombinant Human RNASEL protein, His-tagged | +Inquiry |
| RNASEL-25H | Recombinant Human RNASEL protein, GST-tagged | +Inquiry |
| RNASEL-3916R | Recombinant Rhesus monkey RNASEL Protein, His-tagged | +Inquiry |
| RNASEL-39H | Recombinant Human RNASEL protein, MYC/DDK-tagged | +Inquiry |
| RNASEL-38H | Recombinant Human RNASEL Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASEL Products
Required fields are marked with *
My Review for All RNASEL Products
Required fields are marked with *
