Recombinant Human RNF123 protein, His-tagged

Cat.No. : RNF123-156H
Product Overview : Recombinant Human RNF123(12-358aa) fused with His tag at N-terminal was expressed in E. coli.
Availability January 09, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 12-358 a.a.
Description : The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.
Form : 2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
AA Sequence : RKSYRLTSDAEKSRVTGIVQEKLLNDYLNRIFSSSEHAPPAATSRKPLNFQNLPEHLDQLLQVDNEEEESQGQVE GRLGPSTVVLDHTGGFEGLLLVDDDLLGVIGHSNFGTIRSTTCVYKGKWLYEVLISSQGLMQIGWCTISCRFNQE EGVGDTHNSYAYDGNRVRKWNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAFENLSRGLGMAYFPA ISLSFKESVAFNFGSRPLRYPVAGYRPLQDPPSADLVRAQRLLGCFRAVLSVELDPVEGRLLDKESSKWRLRGQP TVLLTLAHIFHHFAPLLRKVYLVEAVLMSFLLGIVEKGTPTQAQSVV
Stability : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Storage : Storage of Reconstituted ProteinShort-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol soluAon is recommended for longer term storage (see Stability and Storage for more details).If a different concentraAon is needed for your purposes please adjust the reconsAtuAon volume as required (please note: the ion concentration of the final soluAon will vary according to the volume used).Note: Centrifuge vial before opening. When reconsAtuAng, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into soluAon.
Gene Name RNF123 ring finger protein 123 [ Homo sapiens ]
Official Symbol RNF123
Synonyms RNF123; ring finger protein 123; E3 ubiquitin-protein ligase RNF123; FLJ12565; kip1 ubiquitination-promoting complex protein 1; KPC1; FP1477; MGC163504; DKFZp686C2222;
Gene ID 63891
mRNA Refseq NM_022064
Protein Refseq NP_071347
MIM 614472
UniProt ID Q5XPI4
Chromosome Location 3p24.3
Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem;
Function ligase activity; metal ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNF123 Products

Required fields are marked with *

My Review for All RNF123 Products

Required fields are marked with *

0
cart-icon
0
compare icon