Recombinant Human RNF125 Protein (1-232 aa), GST-tagged

Cat.No. : RNF125-2119H
Product Overview : Recombinant Human RNF125 Protein (1-232 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-232 aa
Description : E3 ubiquitin-protein ligase that acts as a positive regulator of T-cell activation. E3 ligase proteins mediate ubiquitination and subsequent proteasomal degradation of target proteins.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 53.3 kDa
AA Sequence : GSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name RNF125 ring finger protein 125, E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol RNF125
Synonyms RNF125; ring finger protein 125; FLJ20456; TRAC1; TRAC-1; MGC21737;
Gene ID 54941
mRNA Refseq NM_017831
Protein Refseq NP_060301
MIM 610432
UniProt ID Q96EQ8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNF125 Products

Required fields are marked with *

My Review for All RNF125 Products

Required fields are marked with *

0
cart-icon