Recombinant Human RNF125 Protein (1-232 aa), GST-tagged
Cat.No. : | RNF125-2119H |
Product Overview : | Recombinant Human RNF125 Protein (1-232 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-232 aa |
Description : | E3 ubiquitin-protein ligase that acts as a positive regulator of T-cell activation. E3 ligase proteins mediate ubiquitination and subsequent proteasomal degradation of target proteins. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 53.3 kDa |
AA Sequence : | GSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | RNF125 ring finger protein 125, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | RNF125 |
Synonyms | RNF125; ring finger protein 125; FLJ20456; TRAC1; TRAC-1; MGC21737; |
Gene ID | 54941 |
mRNA Refseq | NM_017831 |
Protein Refseq | NP_060301 |
MIM | 610432 |
UniProt ID | Q96EQ8 |
◆ Recombinant Proteins | ||
RNF125-859C | Recombinant Cynomolgus RNF125 Protein, His-tagged | +Inquiry |
RNF125-2646H | Recombinant Human RNF125 protein, His-tagged | +Inquiry |
RNF125-602C | Recombinant Cynomolgus Monkey RNF125 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF125-14294M | Recombinant Mouse RNF125 Protein | +Inquiry |
RNF125-7647M | Recombinant Mouse RNF125 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF125-545HCL | Recombinant Human RNF125 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF125 Products
Required fields are marked with *
My Review for All RNF125 Products
Required fields are marked with *