Recombinant Human RNF125 Protein (1-232 aa), GST-tagged

• Cat.No.: RNF125-2119H
• Product Overview: Recombinant Human RNF125 Protein (1-232 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-232 aa
• Description: E3 ubiquitin-protein ligase that acts as a positive regulator of T-cell activation. E3 ligase proteins mediate ubiquitination and subsequent proteasomal degradation of target proteins.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 53.3 kDa
• AA Sequence: GSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: RNF125 ring finger protein 125, E3 ubiquitin protein ligase [ Homo sapiens ]
• Official Symbol: RNF125
• Synonyms: RNF125; ring finger protein 125; FLJ20456; TRAC1; TRAC-1; MGC21737
• Gene ID: 54941
• mRNA Refseq: NM_017831
• Protein Refseq: NP_060301
• MIM: 610432
• UniProt ID: Q96EQ8