Recombinant Human RNF128 protein, GST-tagged
Cat.No. : | RNF128-301144H |
Product Overview : | Recombinant Human RNF128 (333-428 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asp333-Ser428 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | DGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETAVREIKS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RNF128 ring finger protein 128, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | RNF128 |
Synonyms | RNF128; ring finger protein 128, E3 ubiquitin protein ligase; ring finger protein 128; E3 ubiquitin-protein ligase RNF128; FLJ23516; GRAIL; gene related to anergy in lymphocytes protein; |
Gene ID | 79589 |
mRNA Refseq | NM_024539 |
Protein Refseq | NP_078815 |
MIM | 300439 |
UniProt ID | Q8TEB7 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF128 Products
Required fields are marked with *
My Review for All RNF128 Products
Required fields are marked with *
0
Inquiry Basket