Recombinant Human RNF130, His-tagged
| Cat.No. : | RNF130-31331TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 112-306 of Human RNF130 with a N terminal His tag; 27kDa, |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 112-306 a.a. |
| Description : | The protein encoded by this gene contains a RING finger motif and is similar to g1, a Drosophila zinc-finger protein that is expressed in mesoderm and involved in embryonic development. The expression of the mouse counterpart was found to be upregulated in myeloblastic cells following IL3 deprivation, suggesting that this gene may regulate growth factor withdrawal-induced apoptosis of myeloid precursor cells. |
| Conjugation : | HIS |
| Form : | Lyophilised:reconstitution with 55 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | NARDRNQRRLGDAAKKAISKLTTRTVKKGDKETDPDFDHC AVCIESYKQNDVVRILPCKHVFHKSCVDPWLSEHCTCP MCKLNILKALGIVPNLPCTDNVAFDMERLTRTQAVNRR SALGDLAGDNSLGLEPLRTSGISPLPQDGELTPRTGEINI AVTKEWFIIASFGLLSALTLCYMIIRATASLNANEVEW F |
| Gene Name | RNF130 ring finger protein 130 [ Homo sapiens ] |
| Official Symbol | RNF130 |
| Synonyms | RNF130; ring finger protein 130; E3 ubiquitin-protein ligase RNF130; G1RZFP; GOLIATH; GP; |
| Gene ID | 55819 |
| mRNA Refseq | NM_018434 |
| Protein Refseq | NP_060904 |
| Uniprot ID | Q86XS8 |
| Chromosome Location | 5q35.3 |
| Function | ligase activity; metal ion binding; ubiquitin-protein ligase activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| RNF130-7649M | Recombinant Mouse RNF130 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RNF130-30H | Recombinant Human RNF130 protein, MBP & His-tagged | +Inquiry |
| RNF130-10H | Recombinant Full Length Human RNF130 Protein, GST tagged | +Inquiry |
| RNF130-15H | Recombinant Human RNF130 Protein, GST tagged | +Inquiry |
| RNF130-31331TH | Recombinant Human RNF130, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNF130-2299HCL | Recombinant Human RNF130 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF130 Products
Required fields are marked with *
My Review for All RNF130 Products
Required fields are marked with *
