Recombinant Human RNF139 protein, GST-tagged
| Cat.No. : | RNF139-301441H |
| Product Overview : | Recombinant Human RNF139 protein(511-664 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 511-664 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | QAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | RNF139 ring finger protein 139 [ Homo sapiens ] |
| Official Symbol | RNF139 |
| Synonyms | RNF139; ring finger protein 139; E3 ubiquitin-protein ligase RNF139; HRCA1; RCA1; TRC8; multiple membrane spanning receptor TRC8; patched related protein translocated in renal cancer; translocation in renal carcinoma on chromosome 8 protein; MGC31961; |
| Gene ID | 11236 |
| mRNA Refseq | NM_007218 |
| Protein Refseq | NP_009149 |
| MIM | 603046 |
| UniProt ID | Q8WU17 |
| ◆ Recombinant Proteins | ||
| RNF139-7652M | Recombinant Mouse RNF139 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RNF139-2643C | Recombinant Chicken RNF139 | +Inquiry |
| RNF139-6624Z | Recombinant Zebrafish RNF139 | +Inquiry |
| RNF139-301441H | Recombinant Human RNF139 protein, GST-tagged | +Inquiry |
| RNF139-3746R | Recombinant Rhesus Macaque RNF139 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNF139-2297HCL | Recombinant Human RNF139 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF139 Products
Required fields are marked with *
My Review for All RNF139 Products
Required fields are marked with *
