Recombinant Human RNF139 protein, GST-tagged
Cat.No. : | RNF139-301441H |
Product Overview : | Recombinant Human RNF139 (511-664 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gln511-Asp664 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | QAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RNF139 ring finger protein 139 [ Homo sapiens ] |
Official Symbol | RNF139 |
Synonyms | RNF139; ring finger protein 139; E3 ubiquitin-protein ligase RNF139; HRCA1; RCA1; TRC8; multiple membrane spanning receptor TRC8; patched related protein translocated in renal cancer; translocation in renal carcinoma on chromosome 8 protein; MGC31961; |
Gene ID | 11236 |
mRNA Refseq | NM_007218 |
Protein Refseq | NP_009149 |
MIM | 603046 |
UniProt ID | Q8WU17 |
◆ Recombinant Proteins | ||
RNF139-2643C | Recombinant Chicken RNF139 | +Inquiry |
RNF139-14302M | Recombinant Mouse RNF139 Protein | +Inquiry |
RNF139-7652M | Recombinant Mouse RNF139 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF139-6624Z | Recombinant Zebrafish RNF139 | +Inquiry |
RNF139-301441H | Recombinant Human RNF139 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF139-2297HCL | Recombinant Human RNF139 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF139 Products
Required fields are marked with *
My Review for All RNF139 Products
Required fields are marked with *
0
Inquiry Basket