Recombinant Human RNF144B protein, GST-tagged
Cat.No. : | RNF144B-7685H |
Product Overview : | Recombinant Human RNF144B protein(123-187 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 123-187 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | VADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAE |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | RNF144B ring finger protein 144B [ Homo sapiens ] |
Official Symbol | RNF144B |
Synonyms | RNF144B; ring finger protein 144B; IBR domain containing 2 , IBRDC2; E3 ubiquitin-protein ligase RNF144B; bA528A10.3; IBR domain containing 2; IBR domain-containing protein 2; p53-inducible RING finger protein; PIR2; IBRDC2; p53RFP; KIAA0161; MGC71786; |
mRNA Refseq | NM_182757 |
Protein Refseq | NP_877434 |
UniProt ID | Q7Z419 |
Gene ID | 255488 |
◆ Recombinant Proteins | ||
RFL3160BF | Recombinant Full Length Bovine E3 Ubiquitin-Protein Ligase Rnf144B(Rnf144B) Protein, His-Tagged | +Inquiry |
RFL31695MF | Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase Rnf144B(Rnf144B) Protein, His-Tagged | +Inquiry |
RNF144B-683H | Recombinant Human RNF144B Protein, GST/His-tagged | +Inquiry |
RNF144B-7685H | Recombinant Human RNF144B protein, GST-tagged | +Inquiry |
RNF144B-14306M | Recombinant Mouse RNF144B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF144B-2293HCL | Recombinant Human RNF144B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF144B Products
Required fields are marked with *
My Review for All RNF144B Products
Required fields are marked with *