Recombinant Human RNF220 Protein, GST-tagged

Cat.No. : RNF220-4218H
Product Overview : Human FLJ10597 partial ORF ( NP_060620, 468 a.a. - 566 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RNF220 (Ring Finger Protein 220) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ligase activity and ubiquitin-protein transferase activity.
Molecular Mass : 36.63 kDa
AA Sequence : QEAMQKTCKNSDIEKITEDSAVTTFEALKARVRELERQLSRGDRYKCLICMDSYSMPLTSIQCWHVHCEECWLRTLGAKKLCPQCNTITAPGDLRRIYL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RNF220 ring finger protein 220 [ Homo sapiens ]
Official Symbol RNF220
Synonyms RNF220; ring finger protein 220; C1orf164, chromosome 1 open reading frame 164; E3 ubiquitin-protein ligase RNF220; FLJ10597; C1orf164; RP4-678E16.1;
Gene ID 55182
mRNA Refseq NM_018150
Protein Refseq NP_060620
MIM 616136
UniProt ID Q5VTB9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNF220 Products

Required fields are marked with *

My Review for All RNF220 Products

Required fields are marked with *

0
cart-icon
0
compare icon