Recombinant Human RNF220 Protein, GST-tagged
Cat.No. : | RNF220-4218H |
Product Overview : | Human FLJ10597 partial ORF ( NP_060620, 468 a.a. - 566 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | RNF220 (Ring Finger Protein 220) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ligase activity and ubiquitin-protein transferase activity. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | QEAMQKTCKNSDIEKITEDSAVTTFEALKARVRELERQLSRGDRYKCLICMDSYSMPLTSIQCWHVHCEECWLRTLGAKKLCPQCNTITAPGDLRRIYL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RNF220 ring finger protein 220 [ Homo sapiens ] |
Official Symbol | RNF220 |
Synonyms | RNF220; ring finger protein 220; C1orf164, chromosome 1 open reading frame 164; E3 ubiquitin-protein ligase RNF220; FLJ10597; C1orf164; RP4-678E16.1; |
Gene ID | 55182 |
mRNA Refseq | NM_018150 |
Protein Refseq | NP_060620 |
MIM | 616136 |
UniProt ID | Q5VTB9 |
◆ Recombinant Proteins | ||
Rnf220-5555M | Recombinant Mouse Rnf220 Protein, Myc/DDK-tagged | +Inquiry |
RNF220-4218H | Recombinant Human RNF220 Protein, GST-tagged | +Inquiry |
RNF220-7679M | Recombinant Mouse RNF220 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF220-14338M | Recombinant Mouse RNF220 Protein | +Inquiry |
RNF220-3766C | Recombinant Chicken RNF220 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF220-2281HCL | Recombinant Human RNF220 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF220 Products
Required fields are marked with *
My Review for All RNF220 Products
Required fields are marked with *
0
Inquiry Basket