Recombinant Human RO60 protein, His-tagged
| Cat.No. : | RO60-3623H |
| Product Overview : | Recombinant Human RO60 protein(P10155)(3-535aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 3-535aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 64.1 kDa |
| AA Sequence : | ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| RO60-3623H | Recombinant Human RO60 protein, His-tagged | +Inquiry |
| RO60-1734HFL | Recombinant Full Length Human RO60 Protein, C-Flag-tagged | +Inquiry |
| RO60-5961H | Recombinant Human RO60 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RO60-5477H | Recombinant Human RO60 Protein (Met1-IIe538), C-His tagged | +Inquiry |
| RO60-17H | Recombinant Human RO60 Protein, N-6×His tagged, Biotinlyated | +Inquiry |
| ◆ Native Proteins | ||
| RO60-16C | Native Cattle RO60 Protein, Biotinlyated | +Inquiry |
| RO60-18C | Native Cattle RO60 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RO60 Products
Required fields are marked with *
My Review for All RO60 Products
Required fields are marked with *
