Recombinant Human ROPN1 protein, His-tagged

Cat.No. : ROPN1-4432H
Product Overview : Recombinant Human ROPN1 protein(Q9HAT0)(1-212aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-212aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 30.8 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHVSRMLNYMEQEVIGPDGIITVNDFTQNPRVQLE
Gene Name ROPN1 rhophilin associated tail protein 1 [ Homo sapiens ]
Official Symbol ROPN1
Synonyms ROPN1; rhophilin associated tail protein 1; ropporin, rhophilin associated protein 1; ropporin-1A; cancer/testis antigen 91; CT91; ODF6; ROPN1A; ropporin; rhophilin-associated protein 1A; outer dense fiber of sperm tails 6; RHPNAP1; DKFZp434B1222;
Gene ID 54763
mRNA Refseq NM_017578
Protein Refseq NP_060048
MIM 611757
UniProt ID Q9HAT0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ROPN1 Products

Required fields are marked with *

My Review for All ROPN1 Products

Required fields are marked with *

0
cart-icon