Recombinant Human ROPN1 protein, His-tagged

• Cat.No.: ROPN1-4432H
• Product Overview: Recombinant Human ROPN1 protein(Q9HAT0)(1-212aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-212aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.8 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHVSRMLNYMEQEVIGPDGIITVNDFTQNPRVQLE

Gene Information

• Gene Name: ROPN1 rhophilin associated tail protein 1 [ Homo sapiens ]
• Official Symbol: ROPN1
• Synonyms: ROPN1; rhophilin associated tail protein 1; ropporin, rhophilin associated protein 1; ropporin-1A; cancer/testis antigen 91; CT91; ODF6; ROPN1A; ropporin; rhophilin-associated protein 1A; outer dense fiber of sperm tails 6; RHPNAP1; DKFZp434B1222
• Gene ID: 54763
• mRNA Refseq: NM_017578
• Protein Refseq: NP_060048
• MIM: 611757
• UniProt ID: Q9HAT0