Recombinant Human ROPN1 protein, His-tagged
Cat.No. : | ROPN1-4432H |
Product Overview : | Recombinant Human ROPN1 protein(Q9HAT0)(1-212aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-212aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHVSRMLNYMEQEVIGPDGIITVNDFTQNPRVQLE |
Gene Name | ROPN1 rhophilin associated tail protein 1 [ Homo sapiens ] |
Official Symbol | ROPN1 |
Synonyms | ROPN1; rhophilin associated tail protein 1; ropporin, rhophilin associated protein 1; ropporin-1A; cancer/testis antigen 91; CT91; ODF6; ROPN1A; ropporin; rhophilin-associated protein 1A; outer dense fiber of sperm tails 6; RHPNAP1; DKFZp434B1222; |
Gene ID | 54763 |
mRNA Refseq | NM_017578 |
Protein Refseq | NP_060048 |
MIM | 611757 |
UniProt ID | Q9HAT0 |
◆ Recombinant Proteins | ||
ROPN1-14375M | Recombinant Mouse ROPN1 Protein | +Inquiry |
ROPN1-5097R | Recombinant Rat ROPN1 Protein | +Inquiry |
ROPN1-607C | Recombinant Cynomolgus Monkey ROPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ROPN1-4756R | Recombinant Rat ROPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ROPN1-864C | Recombinant Cynomolgus ROPN1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ROPN1-2251HCL | Recombinant Human ROPN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROPN1 Products
Required fields are marked with *
My Review for All ROPN1 Products
Required fields are marked with *