Recombinant Human ROR1

• Cat.No.: ROR1-30958TH
• Product Overview: Recombinant fragment of Human ROR1 with a N terminal proprietary tag. Predicted molecular weight 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene is a receptor protein tyrosine kinase that modulates neurite growth in the central nervous system. It is a type I membrane protein and belongs to the ROR subfamily of cell surface receptors. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK
• Sequence Similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. ROR subfamily.Contains 1 FZ (frizzled) domain.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 kringle domain.Contains 1 protein kinase domain.

Gene Information

• Gene Name: ROR1 receptor tyrosine kinase-like orphan receptor 1 [ Homo sapiens ]
• Official Symbol: ROR1
• Synonyms: ROR1; receptor tyrosine kinase-like orphan receptor 1; NTRKR1; tyrosine-protein kinase transmembrane receptor ROR1
• Gene ID: 4919
• mRNA Refseq: NM_001083592
• Protein Refseq: NP_001077061
• MIM: 602336
• Uniprot ID: Q01973
• Chromosome Location: 1p32-p31
• Pathway: Nuclear Receptors, organism-specific biosystem
• Function: ATP binding; Wnt-protein binding; kinase activity; nucleotide binding; receptor activity