Recombinant Human RORC protein, His/Flag-tagged
| Cat.No. : | RORC-15H |
| Product Overview : | RAR-Related Orphan Receptor C Human Recombinant produced in E.Coli is a full length protein consisting of 497 amino acids having a molecular weight of 55.8kDa and fused with 5.5kDa amino-terminal His-Flag tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Flag&His |
| Form : | Sterile filtered colorless solution.RORC protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5. |
| AA Sequence : | MSYYHHHHHHDYDIPTTDYKDDDDKDYKDDDDKENLYFQGEFMRTQIEVIPCKICGDKSSGIHYGVITCEGCKGF FRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQ QQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHL EYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQS VCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQI VLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALV LINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAF PPLYKELFSTETESPVGLSK |
| Purity : | Greater than 80.0% as determined by SDS-PAGE. |
| Storage : | Store at 4 centigrade if entire vial will be used within 2-4 weeks.Store, frozen at -20 centigrade for longer periods of time. Please avoid freeze thaw cycles. |
| Full Length : | Full L. |
| Gene Name | RORC RAR-related orphan receptor C [ Homo sapiens ] |
| Official Symbol | RORC |
| Synonyms | RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539 |
| Gene ID | 6097 |
| mRNA Refseq | NM_001001523 |
| Protein Refseq | NP_001001523 |
| MIM | 602943 |
| UniProt ID | P51449 |
| Chromosome Location | 1q21 |
| Pathway | Circadian rhythm - mammal, organism-specific biosystem; Circadian rhythm - mammal, conserved biosystem; Gene ex |
| Function | DNA binding; ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity; metal ion binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; steroid hormone receptor activity; zinc ion binding |
| ◆ Recombinant Proteins | ||
| Rorc-2027M | Recombinant Mouse Rorc Protein, His-tagged | +Inquiry |
| RORC-631HF | Recombinant Full Length Human RORC Protein, GST-tagged | +Inquiry |
| RORC-2011M | Recombinant Mouse RORC Protein (1-516 aa), His-tagged | +Inquiry |
| RORC-14381M | Recombinant Mouse RORC Protein | +Inquiry |
| RORC-622H | Recombinant Human RORC | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RORC-2245HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
| RORC-2244HCL | Recombinant Human RORC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RORC Products
Required fields are marked with *
My Review for All RORC Products
Required fields are marked with *
