Recombinant Human RPA3 protein, His-tagged
| Cat.No. : | RPA3-2982H |
| Product Overview : | Recombinant Human RPA3 protein(1-121 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-121 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD |
| Gene Name | RPA3 replication protein A3, 14kDa [ Homo sapiens ] |
| Official Symbol | RPA3 |
| Synonyms | RPA3; replication protein A3, 14kDa; replication protein A3 (14kD); replication protein A 14 kDa subunit; REPA3; RP-A p14; RF-A protein 3; replication factor A protein 3; |
| Gene ID | 6119 |
| mRNA Refseq | NM_002947 |
| Protein Refseq | NP_002938 |
| MIM | 179837 |
| UniProt ID | P35244 |
| ◆ Recombinant Proteins | ||
| Il6-024I | Active Recombinant Mouse Il6 Protein (187 aa) | +Inquiry |
| IL6-5433M | Recombinant Macaca mulatta Interleukin 6 (interferon, beta 2) | +Inquiry |
| IL6-4285H | Recombinant Human IL6 Protein (Met1-Met212), C-His tagged | +Inquiry |
| IL6-654D | Recombinant Dog IL6 Protein, His-tagged | +Inquiry |
| IL6-001H | Recombinant Human IL6 Protein | +Inquiry |
| ◆ Native Proteins | ||
| IL6-01SFL | Recombinant Full Length Sheep IL6 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL6 Products
Required fields are marked with *
My Review for All IL6 Products
Required fields are marked with *
