Recombinant Human RPA3 protein, His-tagged
Cat.No. : | RPA3-2982H |
Product Overview : | Recombinant Human RPA3 protein(1-121 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-121 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD |
Gene Name | RPA3 replication protein A3, 14kDa [ Homo sapiens ] |
Official Symbol | RPA3 |
Synonyms | RPA3; replication protein A3, 14kDa; replication protein A3 (14kD); replication protein A 14 kDa subunit; REPA3; RP-A p14; RF-A protein 3; replication factor A protein 3; |
Gene ID | 6119 |
mRNA Refseq | NM_002947 |
Protein Refseq | NP_002938 |
MIM | 179837 |
UniProt ID | P35244 |
◆ Recombinant Proteins | ||
Il6-237I | Active Recombinant Mouse Il6 Protein, His-tagged | +Inquiry |
Il6-321M | Active Recombinant Mouse Il6, Fc-tagged | +Inquiry |
IL6-326 | Recombinant Cynomolgus Monkey IL6 protein | +Inquiry |
IL6-2075R | Recombinant Rhesus Macaque IL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL6-12C | Recombinant Chicken IL6 Protein | +Inquiry |
◆ Native Proteins | ||
IL6-01SFL | Recombinant Full Length Sheep IL6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL6 Products
Required fields are marked with *
My Review for All IL6 Products
Required fields are marked with *