Recombinant Human RPA4 protein, GST-tagged

Cat.No. : RPA4-267H
Product Overview : Recombinant Human RPA4 protein(NP_037479)(1-261 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-261 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name RPA4 replication protein A4, 30kDa [ Homo sapiens ]
Official Symbol RPA4
Synonyms RPA4; replication protein A4, 30kDa; replication protein A4, 34kDa; replication protein A 30 kDa subunit; HSU24186; RP-A p30; RF-A protein 4; replication factor A protein 4; replication protein A complex 34 kd subunit homolog Rpa4; MGC120333; MGC120334;
Gene ID 29935
mRNA Refseq NM_013347
Protein Refseq NP_037479
MIM 300767
UniProt ID Q13156

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPA4 Products

Required fields are marked with *

My Review for All RPA4 Products

Required fields are marked with *

0
cart-icon