Recombinant Human RPA4 protein, GST-tagged
| Cat.No. : | RPA4-267H |
| Product Overview : | Recombinant Human RPA4 protein(NP_037479)(1-261 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-261 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
| Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RPA4 replication protein A4, 30kDa [ Homo sapiens ] |
| Official Symbol | RPA4 |
| Synonyms | RPA4; replication protein A4, 30kDa; replication protein A4, 34kDa; replication protein A 30 kDa subunit; HSU24186; RP-A p30; RF-A protein 4; replication factor A protein 4; replication protein A complex 34 kd subunit homolog Rpa4; MGC120333; MGC120334; |
| Gene ID | 29935 |
| mRNA Refseq | NM_013347 |
| Protein Refseq | NP_037479 |
| MIM | 300767 |
| UniProt ID | Q13156 |
| ◆ Recombinant Proteins | ||
| RPA4-5299H | Recombinant Human RPA4 protein, His-tagged | +Inquiry |
| RPA4-626H | Recombinant Human RPA4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RPA4-2367H | Recombinant Human RPA4, His-tagged | +Inquiry |
| RPA4-267H | Recombinant Human RPA4 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RPA4-2240HCL | Recombinant Human RPA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPA4 Products
Required fields are marked with *
My Review for All RPA4 Products
Required fields are marked with *
