Recombinant Human RPA4 protein, GST-tagged
Cat.No. : | RPA4-267H |
Product Overview : | Recombinant Human RPA4 protein(NP_037479)(1-261 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-261 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RPA4 replication protein A4, 30kDa [ Homo sapiens ] |
Official Symbol | RPA4 |
Synonyms | RPA4; replication protein A4, 30kDa; replication protein A4, 34kDa; replication protein A 30 kDa subunit; HSU24186; RP-A p30; RF-A protein 4; replication factor A protein 4; replication protein A complex 34 kd subunit homolog Rpa4; MGC120333; MGC120334; |
Gene ID | 29935 |
mRNA Refseq | NM_013347 |
Protein Refseq | NP_037479 |
MIM | 300767 |
UniProt ID | Q13156 |
◆ Recombinant Proteins | ||
RPA4-626H | Recombinant Human RPA4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RPA4-5299H | Recombinant Human RPA4 protein, His-tagged | +Inquiry |
RPA4-267H | Recombinant Human RPA4 protein, GST-tagged | +Inquiry |
RPA4-2367H | Recombinant Human RPA4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPA4-2240HCL | Recombinant Human RPA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPA4 Products
Required fields are marked with *
My Review for All RPA4 Products
Required fields are marked with *
0
Inquiry Basket