Recombinant Human RPA4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RPA4-626H |
Product Overview : | RPA4 MS Standard C13 and N15-labeled recombinant protein (NP_037479) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a single-stranded DNA-binding protein that is the 30-kDa subunit of the replication protein A complex. Replication protein A is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. The encoded protein localizes to DNA repair foci and may be involved in the cellular DNA damage response. This protein may also play a role in inhibiting viral replication. |
Molecular Mass : | 28.9 kDa |
AA Sequence : | MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSADTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RPA4 replication protein A4 [ Homo sapiens (human) ] |
Official Symbol | RPA4 |
Synonyms | RPA4; replication protein A4, 30kDa; replication protein A4, 34kDa; replication protein A 30 kDa subunit; HSU24186; RP-A p30; RF-A protein 4; replication factor A protein 4; replication protein A complex 34 kd subunit homolog Rpa4; MGC120333; MGC120334; |
Gene ID | 29935 |
mRNA Refseq | NM_013347 |
Protein Refseq | NP_037479 |
MIM | 300767 |
UniProt ID | Q13156 |
◆ Recombinant Proteins | ||
RPA4-2367H | Recombinant Human RPA4, His-tagged | +Inquiry |
RPA4-5299H | Recombinant Human RPA4 protein, His-tagged | +Inquiry |
RPA4-267H | Recombinant Human RPA4 protein, GST-tagged | +Inquiry |
RPA4-626H | Recombinant Human RPA4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPA4-2240HCL | Recombinant Human RPA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPA4 Products
Required fields are marked with *
My Review for All RPA4 Products
Required fields are marked with *