Recombinant Human RPF2 Protein, GST-tagged
Cat.No. : | RPF2-406H |
Product Overview : | Human BXDC1 full-length ORF ( NP_115570.1, 1 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 62 kDa |
AA Sequence : | MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDHEKKSKRIKKN |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RPF2 ribosome production factor 2 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | RPF2 |
Synonyms | RPF2; ribosome production factor 2 homolog (S. cerevisiae); brix domain containing 1 , BXDC1; ribosome production factor 2 homolog; bA397G5.4; FLJ21087; ribosomal processing factor 2 homolog (S. cerevisiae); homolog of Rpf2; brix domain containing 1; brix domain-containing protein 1; ribosomal processing factor 2 homolog; ribosome biogenesis protein RPF2 homolog; BXDC1; |
Gene ID | 84154 |
mRNA Refseq | NM_032194 |
Protein Refseq | NP_115570 |
UniProt ID | Q9H7B2 |
◆ Recombinant Proteins | ||
RPF2-1692HF | Recombinant Full Length Human RPF2 Protein, GST-tagged | +Inquiry |
RPF2-406H | Recombinant Human RPF2 Protein, GST-tagged | +Inquiry |
RPF2-12770Z | Recombinant Zebrafish RPF2 | +Inquiry |
RPF2-2455H | Recombinant Human RPF2 protein, His-tagged | +Inquiry |
RPF2-3966R | Recombinant Rhesus monkey RPF2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPF2-2235HCL | Recombinant Human RPF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPF2 Products
Required fields are marked with *
My Review for All RPF2 Products
Required fields are marked with *