Recombinant Human RPF2 Protein, GST-tagged

Cat.No. : RPF2-406H
Product Overview : Human BXDC1 full-length ORF ( NP_115570.1, 1 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 62 kDa
AA Sequence : MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDHEKKSKRIKKN
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RPF2 ribosome production factor 2 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol RPF2
Synonyms RPF2; ribosome production factor 2 homolog (S. cerevisiae); brix domain containing 1 , BXDC1; ribosome production factor 2 homolog; bA397G5.4; FLJ21087; ribosomal processing factor 2 homolog (S. cerevisiae); homolog of Rpf2; brix domain containing 1; brix domain-containing protein 1; ribosomal processing factor 2 homolog; ribosome biogenesis protein RPF2 homolog; BXDC1;
Gene ID 84154
mRNA Refseq NM_032194
Protein Refseq NP_115570
UniProt ID Q9H7B2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPF2 Products

Required fields are marked with *

My Review for All RPF2 Products

Required fields are marked with *

0
cart-icon
0
compare icon